Zu "Q9Y2S2" wurden 20 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
NEU
Anti-CRYL1 (Biotin)
Anti-CRYL1 (Biotin)

Artikelnummer: ABS-KB-31847.100

Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -. IF...
Schlagworte: Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, CRYL1 Antibody (Biotin)
Anwendung: ELISA
Wirt: Mouse
Spezies-Reaktivität: human
ab 232,00 €
Bewerten
NEU
Anti-CRYL1 (Biotin)
Anti-CRYL1 (Biotin)

Artikelnummer: ABS-KB-31632.100

Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -. IF...
Schlagworte: Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, CRYL1 Antibody (Biotin)
Anwendung: ELISA
Wirt: Mouse
Spezies-Reaktivität: human
ab 232,00 €
Bewerten
NEU
Anti-CRYL1 (Biotin)
Anti-CRYL1 (Biotin)

Artikelnummer: ABS-KB-31763.100

Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -. IF...
Schlagworte: Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, CRYL1 Antibody (Biotin)
Anwendung: ELISA
Wirt: Mouse
Spezies-Reaktivität: human
ab 232,00 €
Bewerten
NEU
Anti-CRYL1
Anti-CRYL1

Artikelnummer: ABS-KC-32969.100

Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -....
Schlagworte: Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, CRYL1 Antibody
Anwendung: ELISA
Wirt: Mouse
Spezies-Reaktivität: human
ab 232,00 €
Bewerten
NEU
Anti-Human CRYL1 Antibody Pair
Anti-Human CRYL1 Antibody Pair

Artikelnummer: ABS-ES-3180.1

Product Description: Crystallin lambda 1 (CRYL1) is an NAD(H)-dependent enzyme that catalyzes the dehydrogenation of L-gulonate to dehydro-L-gulonate in the uronate cycle, an alternative glucose metabolic pathway responsible for approximately 5% of daily glucose catabolism. The protein is widely expressed in various...
Schlagworte: Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, Human CRYL1 Antibody Pair
Anwendung: ELISA
Wirt: Mouse/Mouse
Spezies-Reaktivität: human
1.080,00 €
Bewerten
NEU
Anti-Human CRYL1 Antibody Pair
Anti-Human CRYL1 Antibody Pair

Artikelnummer: ABS-ES-3179.1

Product Description: Crystallin lambda 1 (CRYL1) is an NAD(H)-dependent enzyme that catalyzes the dehydrogenation of L-gulonate to dehydro-L-gulonate in the uronate cycle, an alternative glucose metabolic pathway responsible for approximately 5% of daily glucose catabolism. The protein is widely expressed in various...
Schlagworte: Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, Human CRYL1 Antibody Pair
Anwendung: ELISA
Wirt: Mouse/Mouse
Spezies-Reaktivität: human
1.080,00 €
Bewerten
NEU
Anti-Human CRYL1 Antibody Pair
Anti-Human CRYL1 Antibody Pair

Artikelnummer: ABS-ES-3178.1

Product Description: Crystallin lambda 1 (CRYL1) is an NAD(H)-dependent enzyme that catalyzes the dehydrogenation of L-gulonate to dehydro-L-gulonate in the uronate cycle, an alternative glucose metabolic pathway responsible for approximately 5% of daily glucose catabolism. The protein is widely expressed in various...
Schlagworte: Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, Human CRYL1 Antibody Pair
Anwendung: ELISA
Wirt: Mouse/Mouse
Spezies-Reaktivität: human
1.080,00 €
Bewerten
Anti-CRYL1
Anti-CRYL1

Artikelnummer: ATA-HPA040403.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 83% and to rat: 81%
Schlagworte: Anti-CRY, Anti-CRYL1, Anti-Gul3DH, EC=1.1.1.45, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase
Anwendung: ICC, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
Human CRYl1 (Crystallin Lambda 1) ELISA Kit
Human CRYl1 (Crystallin Lambda 1) ELISA Kit

Artikelnummer: ELK-ELK5199.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human CRYl1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human CRYl1. Next,...
Schlagworte: CRY, CRYL1, Gul3DH, Lambda-crystallin homolog, L-gulonate 3-dehydrogenase
Anwendung: ELISA
Spezies-Reaktivität: human
ab 374,00 €
Bewerten
Anti-CRY1, CT (Cryptochrome-1, PHLL1)
Anti-CRY1, CT (Cryptochrome-1, PHLL1)

Artikelnummer: C7942-41A.200

Various biochemical, physiological and behavioral processes display circadian rhythms controlled by an internal biological clock. The central "gears" driving this clock appear to be composed of an autoregulatory transcription/posttranslation-based feedback loop. Cryptochrome 1 (CRY1) and 2 (CRY2) are DNA-binding...
Schlagworte: Anti-CRYL1, Anti-Gul3DH, EC=1.1.1.45, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase
Anwendung: ELISA, IHC, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
Crystallin Lambda 1 (CRYl1) Recombinant, Human
Crystallin Lambda 1 (CRYl1) Recombinant, Human

Artikelnummer: 154219.10

Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9Y2S2, Fragment: Met1~Gln319 (Accession No: Q9Y2S2), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MASSAAGCVV IVGSGVIGRS WAMLFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG...
ab 454,00 €
Bewerten
Crystallin Lambda 1 (CRYl1) Recombinant, Human
Crystallin Lambda 1 (CRYl1) Recombinant, Human

Artikelnummer: 154220.10

Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9Y2S2, Fragment: Leu24~Tyr232 (Accession No: Q9Y2S2), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-LFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG SLKGSLSVEE QLSLISGCPN IQEAVEGAMH...
ab 454,00 €
Bewerten
1 von 2 Seiten