- Suchergebnis für Q9Y2S2
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9Y2S2" wurden 20 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
NEU
Artikelnummer: ABS-KB-31847.100
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -. IF...
| Schlagworte: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, CRYL1 Antibody (Biotin) |
| Anwendung: | ELISA |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 232,00 €
NEU
Artikelnummer: ABS-KB-31632.100
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -. IF...
| Schlagworte: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, CRYL1 Antibody (Biotin) |
| Anwendung: | ELISA |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 232,00 €
NEU
Artikelnummer: ABS-KB-31763.100
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -. IF...
| Schlagworte: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, CRYL1 Antibody (Biotin) |
| Anwendung: | ELISA |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 232,00 €
NEU
Artikelnummer: ABS-KC-32969.100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide. Identity-Mouse (%): 84%. Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 79%, Cynomolgus monkey - 98%. IHC Verification: -. WB Verification: -. IP Verification: -....
| Schlagworte: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, CRYL1 Antibody |
| Anwendung: | ELISA |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 232,00 €
NEU
Artikelnummer: ABS-ES-3180.1
Product Description: Crystallin lambda 1 (CRYL1) is an NAD(H)-dependent enzyme that catalyzes the dehydrogenation of L-gulonate to dehydro-L-gulonate in the uronate cycle, an alternative glucose metabolic pathway responsible for approximately 5% of daily glucose catabolism. The protein is widely expressed in various...
| Schlagworte: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, Human CRYL1 Antibody Pair |
| Anwendung: | ELISA |
| Wirt: | Mouse/Mouse |
| Spezies-Reaktivität: | human |
1.080,00 €
NEU
Artikelnummer: ABS-ES-3179.1
Product Description: Crystallin lambda 1 (CRYL1) is an NAD(H)-dependent enzyme that catalyzes the dehydrogenation of L-gulonate to dehydro-L-gulonate in the uronate cycle, an alternative glucose metabolic pathway responsible for approximately 5% of daily glucose catabolism. The protein is widely expressed in various...
| Schlagworte: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, Human CRYL1 Antibody Pair |
| Anwendung: | ELISA |
| Wirt: | Mouse/Mouse |
| Spezies-Reaktivität: | human |
1.080,00 €
NEU
Artikelnummer: ABS-ES-3178.1
Product Description: Crystallin lambda 1 (CRYL1) is an NAD(H)-dependent enzyme that catalyzes the dehydrogenation of L-gulonate to dehydro-L-gulonate in the uronate cycle, an alternative glucose metabolic pathway responsible for approximately 5% of daily glucose catabolism. The protein is widely expressed in various...
| Schlagworte: | Anti-CRYL1, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase, Human CRYL1 Antibody Pair |
| Anwendung: | ELISA |
| Wirt: | Mouse/Mouse |
| Spezies-Reaktivität: | human |
1.080,00 €
Artikelnummer: ATA-HPA040403.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 83% and to rat: 81%
| Schlagworte: | Anti-CRY, Anti-CRYL1, Anti-Gul3DH, EC=1.1.1.45, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: ELK-ELK5199.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human CRYl1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human CRYl1. Next,...
| Schlagworte: | CRY, CRYL1, Gul3DH, Lambda-crystallin homolog, L-gulonate 3-dehydrogenase |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 374,00 €
Artikelnummer: C7942-41A.200
Various biochemical, physiological and behavioral processes display circadian rhythms controlled by an internal biological clock. The central "gears" driving this clock appear to be composed of an autoregulatory transcription/posttranslation-based feedback loop. Cryptochrome 1 (CRY1) and 2 (CRY2) are DNA-binding...
| Schlagworte: | Anti-CRYL1, Anti-Gul3DH, EC=1.1.1.45, Anti-Lambda-crystallin homolog, Anti-L-gulonate 3-dehydrogenase |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: 154219.10
Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9Y2S2, Fragment: Met1~Gln319 (Accession No: Q9Y2S2), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MASSAAGCVV IVGSGVIGRS WAMLFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG...
ab 454,00 €
Artikelnummer: 154220.10
Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9Y2S2, Fragment: Leu24~Tyr232 (Accession No: Q9Y2S2), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-LFASGGF QVKLYDIEQQ QIRNALENIR KEMKLLEQAG SLKGSLSVEE QLSLISGCPN IQEAVEGAMH...
ab 454,00 €