Zu "Q9R0T4" wurden 17 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Rat E-Cad (E-Cadherin) ELISA Kit
Artikelnummer: ELK-ELK8615.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat E-Cad. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat E-Cad. Next,...
| Schlagworte: | Cdh1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 303,00 €
Rat E-Cad (E-Cadherin) ELISA Kit
Artikelnummer: E-EL-R0347.96
The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of E-Cad in serum, plasma and other biological fluids. Detection Range: 0.16--10ng/mL. Sensitivity: 0.1ng/mL. Protein function: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a...
| Schlagworte: | Cdh1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
392,00 €
Rat E-Cad (E-Cadherin) CLIA Kit
Artikelnummer: E-CL-R0226.96
Type: Sandwich. Detection Range: 31.25~2000pg/mL. Sensitivity: 18.75pg/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat E-Cad . Standards or samples...
| Schlagworte: | Cdh1 |
| Anwendung: | CLIA |
| Spezies-Reaktivität: | rat |
541,00 €
Rat E Cadherin ELISA Kit
Artikelnummer: ARG81924.96
Protein function: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells, cadherins may thus contribute to the sorting of heterogeneous cell types. CDH1 is involved in mechanisms regulating cell-cell adhesions, mobility and...
| Schlagworte: | Cdh1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
1.048,00 €
E-Cadherin/CDH1 Protein (His Tag), recombinant rat
Artikelnummer: E-PDMR100006.100
Activity: Testing in progress Protein Construction: A DNA sequence encoding the Rat VE-Cadherin protein (Q9R0T4) (1-713) was expressed with a C-His. Sequence: Met1-Ala713. Fusion tag: C-His Endotoxin: Please contact us for more information. Apparent Molecular Mass: 80 kDa. Protein function: Cadherins are...
| Schlagworte: | Cdh1, Recombinant Rat E-Cadherin/CDH1 Protein (His Tag) |
| Exprimiert in: | Human cells |
| Ursprungsart: | rat |
| MW: | 78.32 kD |
ab 224,00 €
Rat E-Cad (E-Cadherin) CLIA Kit
Artikelnummer: E-CL-R0226.24
Type: Sandwich. Detection Range: 31.25~2000pg/mL. Sensitivity: 18.75pg/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat E-Cad . Standards or samples...
| Schlagworte: | Cdh1 |
| Anwendung: | CLIA |
| Spezies-Reaktivität: | rat |
ab 142,00 €
Rat E-Cad (E-Cadherin) ELISA Kit
Artikelnummer: E-EL-R0347.24
The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of E-Cad in serum, plasma and other biological fluids. Detection Range: 0.16--10ng/mL. Sensitivity: 0.1ng/mL. Protein function: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a...
| Schlagworte: | Cdh1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 118,00 €
Uncoated Rat E-Cad(E-Cadherin) ELISA Kit
Artikelnummer: E-UNEL-R0018.15
Colormetric. Detection Range: 0.15625-10 ng/mL. Protein function: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells, cadherins may thus contribute to the sorting of heterogeneous cell types. CDH1 is involved in mechanisms...
| Schlagworte: | Cdh1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 396,00 €
Rat E-Cadherin ELISA Kit
Artikelnummer: KOA0867
Natural and recombinant rat E-Cadherin. There is no detectable cross-reactivity with other relevant proteins. Protein function: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells, cadherins may thus contribute to the sorting...
| Schlagworte: | Cdh1 |
| Anwendung: | ELISA |
| Wirt: | Rat |
| Spezies-Reaktivität: | rat |
848,00 €
Cdh1, Rat cadherin 1, Real Time PCR Primer Set
Artikelnummer: VRPS-982
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Cdh1, CD324, Uvomorulin, E-Cad/CTF3, Cadherin-1, E-cadherin, E-Cad/CTF1, E-Cad/CTF2, Epithelial cadherin |
| Anwendung: | RNA quantification |
52,00 €
Cadherin, Epithelial (CDHE) Recombinant, Rat
Artikelnummer: 153760.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9R0T4, Fragment: Asp374~Ser628 (Accession No: Q9R0T4), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-DNAPIFN PSTYQGQVLE NEVGARIATL KVTDDDAPNT PAWNAVYTVV NDPDHQFTVI TDPKTNEGIL...
ab 409,00 €
E-Cadherin BioAssay(TM) ELISA Kit (Rat)
Artikelnummer: 396634.96
Cadherin-1, also known as CAM 120/80 or epithelial cadherin (E-cadherin) or uvomorulin, is a protein that in humans is encoded by the CDH1 gene. E-cadherin is a Ca(2+)-dependent epithelial cell-cell adhesion molecule. Downregulation of E-cadherin expression often correlates with strong invasive potential and poor...
| Schlagworte: | Cdh1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
947,00 €