- Suchergebnis für Q9NX36
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9NX36" wurden 10 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA018003.100
Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 87%
| Schlagworte: | Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ATA-HPA030076.100
Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 64% and to rat: 62%
| Schlagworte: | Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ATA-HPA077153.100
Polyclonal Antibody against Human DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Validated applications: ICC, Uniprot ID: Q9NX36, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May...
| Schlagworte: | Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-6754-L.100
Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium]
| Schlagworte: | DnaJ homolog subfamily C member 28, Recombinant Human DNAJC28 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.5 kD |
ab 115,00 €
Artikelnummer: VHPS-1239
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | DNAJC28, C21orf55, DnaJ homolog subfamily C member 28 |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: 034719.200
DNAJC28 may have a role in protein folding or as a chaperone. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots...
| Schlagworte: | Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: ATA-APrEST73895.100
Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | DNAJC28, C21orf55, DnaJ homolog subfamily C member 28 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ATA-APrEST78840.100
Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | DNAJC28, C21orf55, DnaJ homolog subfamily C member 28 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-PP-6754.100
Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium]
| Schlagworte: | DnaJ homolog subfamily C member 28, Recombinant Human DNAJC28 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST96141.100
PrEST Antigen DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Antigen sequence: VLSHVIEQTNASQSKGEEEEDVEKFKYKTPQHRHYLSFEGIGFGTPTQREKHYRQFRADRAAEQVMEYQKQKLQSQYFPDSVIVKNIRQSKQQKITQAI, Storage: Upon delivery store at -20°C. Avoid repeated...
| Schlagworte: | DNAJC28, C21orf55, DnaJ homolog subfamily C member 28 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €