- Suchergebnis für Q9NUL3
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9NUL3" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: E-AB-18765.120
Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind...
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, STAU2 Polyclonal Antibody |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 89,00 €
Artikelnummer: E-AB-52678.120
Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind...
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, STAU2 Polyclonal Antibody |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 89,00 €
Artikelnummer: ATA-HPA075293.100
Polyclonal Antibody against Human STAU2, Gene description: staufen double-stranded RNA binding protein 2, Alternative Gene Names: 39K2, Validated applications: IHC, WB, Uniprot ID: Q9NUL3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: RNA-binding protein...
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2 |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-9586-L.100
Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from...
| Schlagworte: | Double-stranded RNA-binding protein Staufen homolog 2, Recombinant Human STAU2 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 28 kD |
ab 115,00 €
Artikelnummer: G-CAB3413.20
Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from...
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2 |
| Anwendung: | WB, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
103,00 €
Artikelnummer: ELK-ES12908.100
Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind...
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, STAU2 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
Artikelnummer: CSB-CL885729HU1.10
Length: 318 Sequence: atgcttcaaa taaatcagat gttctcagtg cagctgagtc ttggtgagca gacatgggaa tccgaaggca gcagtataaa gaaggctcag caggctgttg ccaataaagc tttgactgaa tctacgcttc ccaaaccagt tcagaagcca cccaaaagta atgttaacaa taacccaggc agtataactc caactgtgga actgaatggg cttgctatga aaaggggaga gcctgccatc tacaggccat tagatccaaa...
| Schlagworte: | STAU2, Double-stranded RNA-binding protein Staufen homolog 2 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Artikelnummer: CSB-CL885729HU2.10
Length: 1617 Sequence: atgcttcaaa taaatcagat gttctcagtg cagctgagtc ttggtgagca gacatgggaa tccgaaggca gcagtataaa gaaggctcag caggctgttg ccaataaagc tttgactgaa tctacgcttc ccaaaccagt tcagaagcca cccaaaagta atgttaacaa taacccaggc agtataactc caactgtgga actgaatggg cttgctatga aaaggggaga gcctgccatc tacaggccat tagatccaaa...
| Schlagworte: | STAU2, Double-stranded RNA-binding protein Staufen homolog 2 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
357,00 €
Artikelnummer: CSB-PA022819GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: STAU2. Antigen Species: Human
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, 39K2 antibody, 39K3 antibody, DKFZp781K0371... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
Artikelnummer: CSB-PA885729ESR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: STAU2. Antigen Species: Human
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, 39K2 antibody, 39K3 antibody, DKFZp781K0371... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: ABS-PP-9586.100
Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from...
| Schlagworte: | Double-stranded RNA-binding protein Staufen homolog 2, Recombinant Human STAU2 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 28 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95800.100
PrEST Antigen STAU2, Gene description: staufen double-stranded RNA binding protein 2, Alternative Gene Names: 39K2, Antigen sequence: CSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding...
| Schlagworte: | STAU2, Double-stranded RNA-binding protein Staufen homolog 2 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €