Zu "Q9NUL3" wurden 12 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-STAU2
Artikelnummer: E-AB-18765.120
Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind...
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, STAU2 Polyclonal Antibody |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 89,00 €
Anti-STAU2
Artikelnummer: E-AB-52678.120
Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind...
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, STAU2 Polyclonal Antibody |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 89,00 €
Anti-STAU2
Artikelnummer: ATA-HPA075293.100
Polyclonal Antibody against Human STAU2, Gene description: staufen double-stranded RNA binding protein 2, Alternative Gene Names: 39K2, Validated applications: IHC, WB, Uniprot ID: Q9NUL3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: RNA-binding protein...
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2 |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
STAU2 (human), recombinant protein
Artikelnummer: ABS-PP-9586-L.100
Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from...
| Schlagworte: | Double-stranded RNA-binding protein Staufen homolog 2, Recombinant Human STAU2 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 28 kD |
ab 115,00 €
Anti-STAU2
Artikelnummer: G-CAB3413.20
Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from...
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2 |
| Anwendung: | WB, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
103,00 €
Anti-STAU2
Artikelnummer: ELK-ES12908.100
Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind...
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, STAU2 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
STAU2 (Vector Vector will be determined during the...
Artikelnummer: CSB-CL885729HU1.10
Length: 318 Sequence: atgcttcaaa taaatcagat gttctcagtg cagctgagtc ttggtgagca gacatgggaa tccgaaggca gcagtataaa gaaggctcag caggctgttg ccaataaagc tttgactgaa tctacgcttc ccaaaccagt tcagaagcca cccaaaagta atgttaacaa taacccaggc agtataactc caactgtgga actgaatggg cttgctatga aaaggggaga gcctgccatc tacaggccat tagatccaaa...
| Schlagworte: | STAU2, Double-stranded RNA-binding protein Staufen homolog 2 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
STAU2 (Vector Vector will be determined during the...
Artikelnummer: CSB-CL885729HU2.10
Length: 1617 Sequence: atgcttcaaa taaatcagat gttctcagtg cagctgagtc ttggtgagca gacatgggaa tccgaaggca gcagtataaa gaaggctcag caggctgttg ccaataaagc tttgactgaa tctacgcttc ccaaaccagt tcagaagcca cccaaaagta atgttaacaa taacccaggc agtataactc caactgtgga actgaatggg cttgctatga aaaggggaga gcctgccatc tacaggccat tagatccaaa...
| Schlagworte: | STAU2, Double-stranded RNA-binding protein Staufen homolog 2 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
357,00 €
Anti-STAU2
Artikelnummer: CSB-PA022819GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: STAU2. Antigen Species: Human
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, 39K2 antibody, 39K3 antibody, DKFZp781K0371... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
Anti-STAU2
Artikelnummer: CSB-PA885729ESR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: STAU2. Antigen Species: Human
| Schlagworte: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, 39K2 antibody, 39K3 antibody, DKFZp781K0371... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
STAU2 (human), recombinant protein
Artikelnummer: ABS-PP-9586.100
Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from...
| Schlagworte: | Double-stranded RNA-binding protein Staufen homolog 2, Recombinant Human STAU2 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 28 kD |
ab 90,00 €
STAU2 PrEST Antigen
Artikelnummer: ATA-APrEST95800.100
PrEST Antigen STAU2, Gene description: staufen double-stranded RNA binding protein 2, Alternative Gene Names: 39K2, Antigen sequence: CSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding...
| Schlagworte: | STAU2, Double-stranded RNA-binding protein Staufen homolog 2 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €