Zu "Q9NSI2" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-FAM207A
Artikelnummer: ATA-HPA036354.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 54% and to rat: 52%
| Schlagworte: | Anti-PRED56, Anti-FAM207A, Anti-C21orf70, Anti-Protein FAM207A |
| Anwendung: | ICC, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-SLX9
Artikelnummer: ATA-HPA036559.100
Polyclonal Antibody against Human SLX9, Gene description: SLX9 ribosome biogenesis factor, Alternative Gene Names: C21orf70, FAM207A, PRED56, Validated applications: ICC, Uniprot ID: Q9NSI2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene...
| Schlagworte: | Anti-PRED56, Anti-FAM207A, Anti-C21orf70, Anti-Protein FAM207A |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
463,00 €
SLX9 (human), recombinant protein
Artikelnummer: ABS-PP-7089-L.100
| Schlagworte: | Ribosome biogenesis protein SLX9 homolog, Recombinant Human SLX9 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 10.5 kD |
ab 115,00 €
Anti-CU070, CT (FAM207A, C21orf70, Protein FAM207A)
Artikelnummer: 034360.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
| Schlagworte: | Anti-PRED56, Anti-FAM207A, Anti-C21orf70, Anti-Protein FAM207A |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
865,00 €
FAM207A PrEST Antigen
Artikelnummer: ATA-APrEST78832.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | PRED56, FAM207A, C21orf70, Protein FAM207A |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-F207A
Artikelnummer: ELK-ES16604.100
Protein function: May be involved in ribosome biogenesis. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Nucleus, nucleolus .
| Schlagworte: | Anti-PRED56, Anti-C21orf70, Anti-Ribosome biogenesis protein SLX9 homolog, F207A rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
SLX9 (human), recombinant protein
Artikelnummer: ABS-PP-7089.100
| Schlagworte: | Ribosome biogenesis protein SLX9 homolog, Recombinant Human SLX9 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 10.5 kD |
ab 90,00 €
SLX9 PrEST Antigen
Artikelnummer: ATA-APrEST95873.100
PrEST Antigen SLX9, Gene description: SLX9 ribosome biogenesis factor, Alternative Gene Names: C21orf70, FAM207A, PRED56, Antigen sequence: KLAEQKHREERRRRATVVVGHLHPLRDALPELLGLEAGSRRQACSRESNKPWPSELSRMSAAQRQQLLEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 72% Rat...
| Schlagworte: | PRED56, FAM207A, C21orf70, Protein FAM207A |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €