Zu "Q9NSI2" wurden 9 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-FAM207A
Anti-FAM207A

Artikelnummer: ATA-HPA036354.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 54% and to rat: 52%
Schlagworte: Anti-PRED56, Anti-FAM207A, Anti-C21orf70, Anti-Protein FAM207A
Anwendung: ICC, IHC, WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
Anti-SLX9
Anti-SLX9

Artikelnummer: ATA-HPA036559.100

Polyclonal Antibody against Human SLX9, Gene description: SLX9 ribosome biogenesis factor, Alternative Gene Names: C21orf70, FAM207A, PRED56, Validated applications: ICC, Uniprot ID: Q9NSI2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene...
Schlagworte: Anti-PRED56, Anti-FAM207A, Anti-C21orf70, Anti-Protein FAM207A
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
463,00 €
Bewerten
NEU
Anti-SLX9
Anti-SLX9

Artikelnummer: ATA-HPA036559.25

Polyclonal Antibody against Human SLX9, Gene description: SLX9 ribosome biogenesis factor, Alternative Gene Names: C21orf70, FAM207A, PRED56, Validated applications: ICC, Uniprot ID: Q9NSI2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene...
Schlagworte: Anti-PRED56, Anti-FAM207A, Anti-C21orf70, Anti-Protein FAM207A
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
323,00 €
Bewerten
SLX9 (human), recombinant protein
SLX9 (human), recombinant protein

Artikelnummer: ABS-PP-7089-L.100

Schlagworte: Ribosome biogenesis protein SLX9 homolog, Recombinant Human SLX9 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 10.5 kD
ab 115,00 €
Bewerten
Anti-CU070, CT (FAM207A, C21orf70, Protein FAM207A)
Anti-CU070, CT (FAM207A, C21orf70, Protein FAM207A)

Artikelnummer: 034360.200

Applications:, Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
Schlagworte: Anti-PRED56, Anti-FAM207A, Anti-C21orf70, Anti-Protein FAM207A
Anwendung: ELISA, IHC, WB
Wirt: Rabbit
Spezies-Reaktivität: mouse
865,00 €
Bewerten
FAM207A PrEST Antigen
FAM207A PrEST Antigen

Artikelnummer: ATA-APrEST78832.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: PRED56, FAM207A, C21orf70, Protein FAM207A
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-F207A
Anti-F207A

Artikelnummer: ELK-ES16604.100

Protein function: May be involved in ribosome biogenesis. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Nucleus, nucleolus .
Schlagworte: Anti-PRED56, Anti-C21orf70, Anti-Ribosome biogenesis protein SLX9 homolog, F207A rabbit pAb
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 173,00 €
Bewerten
SLX9 (human), recombinant protein
SLX9 (human), recombinant protein

Artikelnummer: ABS-PP-7089.100

Schlagworte: Ribosome biogenesis protein SLX9 homolog, Recombinant Human SLX9 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 10.5 kD
ab 90,00 €
Bewerten
SLX9 PrEST Antigen
SLX9 PrEST Antigen

Artikelnummer: ATA-APrEST95873.100

PrEST Antigen SLX9, Gene description: SLX9 ribosome biogenesis factor, Alternative Gene Names: C21orf70, FAM207A, PRED56, Antigen sequence: KLAEQKHREERRRRATVVVGHLHPLRDALPELLGLEAGSRRQACSRESNKPWPSELSRMSAAQRQQLLEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 72% Rat...
Schlagworte: PRED56, FAM207A, C21orf70, Protein FAM207A
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten