- Suchergebnis für Q9C086
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9C086" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA070644.100
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 95% and to rat: 96%
| Schlagworte: | Anti-hIes2, Anti-PAPA-1, Anti-INO80B, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ATA-HPA078274.100
Polyclonal Antibody against Human INO80B, Gene description: INO80 complex subunit B, Alternative Gene Names: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4, Validated applications: ICC, Uniprot ID: Q9C086, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Schlagworte: | Anti-hIes2, Anti-PAPA-1, Anti-INO80B, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA078274.25
Polyclonal Antibody against Human INO80B, Gene description: INO80 complex subunit B, Alternative Gene Names: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4, Validated applications: ICC, Uniprot ID: Q9C086, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Schlagworte: | Anti-hIes2, Anti-PAPA-1, Anti-INO80B, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: VHPS-4177
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | hIes2, PAPA-1, INO80B, HMGA1L4, IES2 homolog, INO80 complex subunit B, PAP-1-associated protein 1, High mobility group... |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: 037040.200
IN80B induces growth and cell cycle arrests at the G1 phase of the cell cycle. Applications: Suitable for use in Western Blot, Flow Cytometry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Flow Cytometry: 1:10-50, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to...
| Schlagworte: | Anti-hIes2, Anti-INO80B, Anti-PAPA-1, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Anwendung: | ELISA, FC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: ATA-APrEST94334.100
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | hIes2, PAPA-1, INO80B, HMGA1L4, IES2 homolog, INO80 complex subunit B, PAP-1-associated protein 1, High mobility group... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ARG44454.50
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium]
| Schlagworte: | Anti-hIes2, Anti-hIes2, Anti-INO80B, Anti-PAPA-1, Anti-PAPA-1, Anti-HMGA1L4, Anti-IES2 homolog, Anti-IES2 homolog,... |
| Anwendung: | FC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
551,00 €
Artikelnummer: CSB-CL011725HU.10
Length: 1032 Sequence: atggaggccc ctgagccggg agaagccctg gagttgagcc tggcgggtgc ccatggccat ggagtgcaca agaaaaaaca caagaagcac aagaagaaac acaagaagaa acaccatcag gaagaagacg ccgggcccac gcagccgtcc cctgccaagc ctcagctcaa actcaaaatc aagcttgggg gacaagtcct ggggaccaag agtgttccta ccttcactgt gatcccagag gggcctcgct caccctctcc...
| Schlagworte: | hIes2, INO80B, PAPA-1, HMGA1L4, IES2 homolog, INO80 complex subunit B, PAP-1-associated protein 1, High mobility group... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
386,00 €
Artikelnummer: ABS-PP-10455.100
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium]
| Schlagworte: | INO80 complex subunit B, High mobility group AT-hook 1-like 4, IES2 homolog, hIes2, PAP-1-associated protein 1, PAPA-1,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 24.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95967.100
PrEST Antigen INO80B, Gene description: INO80 complex subunit B, Alternative Gene Names: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4, Antigen sequence: HKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Schlagworte: | hIes2, PAPA-1, INO80B, HMGA1L4, IES2 homolog, INO80 complex subunit B, PAP-1-associated protein 1, High mobility group... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: NSJ-RQ8607
0.5mg/ml if reconstituted with 0.2ml sterile DI water. INO80 complex subunit B is a protein that in humans is encoded by the INO80B gene. This gene encodes a subunit of an ATP-dependent chromatin remodeling complex, INO80, which plays a role in DNA and nucleosome-activated ATPase activity and ATP-dependent...
| Schlagworte: | Anti-hIes2, Anti-PAPA-1, Anti-INO80B, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Anwendung: | WB, FC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
790,00 €
Artikelnummer: ABS-PP-10455-L.100
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium]
| Schlagworte: | INO80 complex subunit B, High mobility group AT-hook 1-like 4, IES2 homolog, hIes2, PAP-1-associated protein 1, PAPA-1,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 24.5 kD |
ab 115,00 €