- Suchergebnis für Q9BZX4
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9BZX4" wurden 16 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA052529.100
Rabbit Polyclonal ROPN1B Antibody against Human rhophilin associated tail protein 1B. Validated for Western Blot. Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Interspecies information: Highest antigen sequence indentity to the following orthologs: ENSMUSG00000022832: 94%,...
| Schlagworte: | Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
463,00 €
Artikelnummer: G-PACO29584.50
ROPN1B Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. ROPN1B Antibody is a high quality polyclonal antibody for research use only.. Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm...
| Schlagworte: | Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
313,00 €
Artikelnummer: ATA-HPA052530.100
Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA- dependent signaling processes required for spermatozoa capacitation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative....
| Schlagworte: | Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: CSB-EP020065HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-120aa. Protein Length: Partial of Isoform 2. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MWKVVNLPTD LFNSVMNVGR FTEEIEWLKF LALACSALGV TITKTLKIVC EVLSCDHNGG LPRIPFSTFQ FLYTYIAEVD GEICASHVSR MLNYIEQEVI GPDGLITVND FTQNPRVWLE. Purity:...
| Schlagworte: | ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B, Recombinant Human Ropporin-1B (ROPN1B), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 40.6 kD |
ab 219,00 €
Artikelnummer: CSB-YP020065HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 1-120aa. Protein Length: Full Length of isoform 2. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MWKVVNLPTD LFNSVMNVGR FTEEIEWLKF LALACSALGV TITKTLKIVC EVLSCDHNGG LPRIPFSTFQ FLYTYIAEVD GEICASHVSR MLNYIEQEVI GPDGLITVND FTQNPRVWLE. Purity:...
| Schlagworte: | ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B, Recombinant Human Ropporin-1B (ROPN1B) |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | human |
| MW: | 15.6 kD |
ab 242,00 €
Artikelnummer: ABS-PP-7271-L.100
Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA- dependent signaling processes required for spermatozoa capacitation. [The UniProt Consortium]
| Schlagworte: | Ropporin-1B, Rhophilin-associated protein 1B, Recombinant Human ROPN1B Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 23.5 kD |
ab 115,00 €
Artikelnummer: 375080.1
Source:, Recombinant protein corresponding to aa1-120 from human ROPN1B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.6kD, AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE, Storage and Stability: May...
| Schlagworte: | ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B |
| MW: | 40,6 |
ab 603,00 €
Artikelnummer: ATA-APrEST82634.100
Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA- dependent signaling processes required for spermatozoa capacitation. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: 375081.100
Source:, Recombinant protein corresponding to aa1-120 from human Ropporin-1B, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.6kD, AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE, Storage and Stability:...
| Schlagworte: | ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B |
| MW: | 15,6 |
ab 557,00 €
Artikelnummer: ELK-ES13351.100
Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA- dependent signaling processes required for spermatozoa capacitation. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Cell projection,...
| Schlagworte: | Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B, ROP1B rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
Artikelnummer: CSB-CL866334HU.10
Length: 363 Sequence: atgtggaaag tggtgaatct cccaacagat ctgtttaata gtgtgatgaa tgtgggtcgc ttcacggagg agatcgagtg gctgaagttt ttagcccttg cttgcagcgc tctgggagtt actattacca aaactctcaa gatagtgtgt gaggtcttat catgtgacca caatggtggg ttgccccgaa tcccattcag caccttccag tttctctaca cgtatattgc cgaagtggat ggggagatct gtgcatcaca...
| Schlagworte: | ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Artikelnummer: CSB-PA020065ED01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ROPN1B. Antigen Species: Human
| Schlagworte: | Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B, AKAP binding sperm protein ropporin antibody,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €