- Suchergebnis für Q9BSJ5
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9BSJ5" wurden 13 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA012626.100
Rabbit Polyclonal C17orf80 Antibody against Human chromosome 17 open reading frame 80. Validated for Western Blot. Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Interspecies information: Highest antigen sequence indentity to the following orthologs: ENSMUSG00000041623: 51%,...
| Schlagworte: | Anti-HLC8, Anti-HLC-8, Anti-C17orf80, Anti-Uncharacterized protein C17orf80, Anti-Human lung cancer oncogene 8 protein,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
463,00 €
Artikelnummer: ATA-HPA012896.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 51% and to rat: 52%
| Schlagworte: | Anti-HLC8, Anti-HLC-8, Anti-C17orf80, Anti-Uncharacterized protein C17orf80, Anti-Human lung cancer oncogene 8 protein,... |
| Anwendung: | ICC, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA010974.100
Polyclonal Antibody against Human C17orf80, Gene description: chromosome 17 open reading frame 80, Alternative Gene Names: FLJ20721, HLC-8, MIG3, SPEP1, Validated applications: ICC, Uniprot ID: Q9BSJ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 35%...
| Schlagworte: | Anti-HLC8, Anti-HLC-8, Anti-C17orf80, Anti-Uncharacterized protein C17orf80, Anti-Human lung cancer oncogene 8 protein,... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA073479.100
Polyclonal Antibody against Human C17orf80, Gene description: chromosome 17 open reading frame 80, Alternative Gene Names: FLJ20721, HLC-8, MIG3, SPEP1, Validated applications: ICC, WB, Uniprot ID: Q9BSJ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity:...
| Schlagworte: | Anti-HLC8, Anti-HLC-8, Anti-C17orf80, Anti-Uncharacterized protein C17orf80, Anti-Human lung cancer oncogene 8 protein,... |
| Anwendung: | ICC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-2701-L.100
| Schlagworte: | Uncharacterized protein C17orf80, Cell migration-inducing gene 3 protein, Human lung cancer oncogene 8 protein, HLC-8,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15.5 kD |
ab 115,00 €
Artikelnummer: ABS-PQ-767-L.100
| Schlagworte: | Uncharacterized protein C17orf80, Cell migration-inducing gene 3 protein, Human lung cancer oncogene 8 protein, HLC-8,... |
| Exprimiert in: | human cells |
| Ursprungsart: | human |
| MW: | 37.5 kD |
ab 295,00 €
Artikelnummer: VHPS-1095
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | HLC8, HLC-8, C17orf80 C17orf80, Human lung cancer oncogene 8 protein, Cell migration-inducing gene 3 protein |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: ATA-APrEST72009.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | HLC8, HLC-8, C17orf80, Uncharacterized protein C17orf80, Human lung cancer oncogene 8 protein, Cell migration-inducing... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: CSB-CL863113HU.10
Length: 1830 Sequence: atgagtgata atccacccag aatggaagtg tgtccttact gtaagaagcc atttaaacga ttaaaatccc acttgccata ctgtaagatg ataggaccaa ccatacctac tgatcaaaaa gtttatcagt ccaagccagc tacactccca cgtgctaaaa agatgaaagg accaatcaaa gatttaatta aagctaaagg gaaagagtta gagacagaga atgaagaaag aaattctaag ttggtggtgg acaaaccaga...
| Schlagworte: | HLC8, HLC-8, C17orf80, Uncharacterized protein C17orf80, Human lung cancer oncogene 8 protein, Cell migration-inducing... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
670,00 €
Artikelnummer: ABS-PP-2701.100
| Schlagworte: | Uncharacterized protein C17orf80, Cell migration-inducing gene 3 protein, Human lung cancer oncogene 8 protein, HLC-8,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15.5 kD |
ab 90,00 €
Artikelnummer: ABS-PQ-767.100
| Schlagworte: | Uncharacterized protein C17orf80, Cell migration-inducing gene 3 protein, Human lung cancer oncogene 8 protein, HLC-8,... |
| Exprimiert in: | human cells |
| Ursprungsart: | human |
| MW: | 37.5 kD |
ab 270,00 €
Artikelnummer: ATA-APrEST95893.100
PrEST Antigen C17orf80, Gene description: chromosome 17 open reading frame 80, Alternative Gene Names: FLJ20721, HLC-8, MIG3, SPEP1, Antigen sequence: PRETTYQFHSVSQSSSQSLASLATTFLQEKKAEAQNHNCVPDVKALMESPEGQLSLEPKSDSQFQASHTGCQSPLCSAQRHTPQSPFTNHAAAAGRKTLRSCMGLEWFPELYPGYLGLGVLPGKPQCWNAMTQKPQ, Storage: Upon delivery store...
| Schlagworte: | HLC8, HLC-8, C17orf80, Uncharacterized protein C17orf80, Human lung cancer oncogene 8 protein, Cell migration-inducing... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €