- Suchergebnis für Q9BRR8
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9BRR8" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA043430.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 85% and to rat: 85%
| Schlagworte: | Anti-ECGP, Anti-GPATCH1, Anti-G patch domain-containing protein 1, Anti-Evolutionarily conserved G-patch domain-containing... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ATA-HPA043604.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 88% and to rat: 88%
| Schlagworte: | Anti-ECGP, Anti-GPATCH1, Anti-G patch domain-containing protein 1, Anti-Evolutionarily conserved G-patch domain-containing... |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 246,00 €
Artikelnummer: ATA-HPA074327.100
Polyclonal Antibody against Human GPATCH1, Gene description: G-patch domain containing 1, Alternative Gene Names: ECGP, FLJ10206, FLJ38686, GPATC1, Validated applications: ICC, Uniprot ID: Q9BRR8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 86% Rat...
| Schlagworte: | Anti-ECGP, Anti-GPATCH1, Anti-G patch domain-containing protein 1, Anti-Evolutionarily conserved G-patch domain-containing... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA074327.25
Polyclonal Antibody against Human GPATCH1, Gene description: G-patch domain containing 1, Alternative Gene Names: ECGP, FLJ10206, FLJ38686, GPATC1, Validated applications: ICC, Uniprot ID: Q9BRR8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 86% Rat...
| Schlagworte: | Anti-ECGP, Anti-GPATCH1, Anti-G patch domain-containing protein 1, Anti-Evolutionarily conserved G-patch domain-containing... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: ATA-APrEST82457.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ECGP, GPATCH1, G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ATA-APrEST82458.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ECGP, GPATCH1, G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-PP-6825.100
| Schlagworte: | G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein, Recombinant Human GPATCH1... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 19 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95616.100
PrEST Antigen GPATCH1, Gene description: G-patch domain containing 1, Alternative Gene Names: ECGP, FLJ10206, FLJ38686, GPATC1, Antigen sequence: RYVGKILDGFSLASKPLSSKKIYPPPELPRDYRPVHYFRPMVAATSENSHLLQVLSESAGKATPDPGTHSKHQLNASKRAELLGETPIQGSATSVL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Schlagworte: | ECGP, GPATCH1, G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-PP-6825-L.100
| Schlagworte: | G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein, Recombinant Human GPATCH1... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 19 kD |
ab 115,00 €