- Suchergebnis für Q96S44
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q96S44" wurden 11 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA015837.100
Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
| Schlagworte: | Anti-Nori-2, Anti-C20orf64, Anti-TP53-regulating kinase, Anti-p53-related protein kinase, Anti-EKC/KEOPS complex subunit... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA075054.100
Polyclonal Antibody against Human TP53RK, Gene description: TP53 regulating kinase, Alternative Gene Names: BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk, TPRKB, Validated applications: IHC, WB, Uniprot ID: Q96S44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Schlagworte: | Anti-Nori-2, Anti-C20orf64, Anti-TP53-regulating kinase, Anti-p53-related protein kinase, Anti-EKC/KEOPS complex subunit... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-12434-L.100
Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
| Schlagworte: | EKC/KEOPS complex subunit TP53RK, Atypical serine/threonine protein kinase TP53RK, Nori-2, TP53-regulating kinase,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 29 kD |
ab 115,00 €
Artikelnummer: 009-001-U16S
Recombinant full-length human TP53RK was expressed by baculovirus in Sf9 insect cells using an N-Terminal Glutathione-S-Transferase fusion protein. The purity was determined to be >80% by densitometry. Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl...
| Schlagworte: | TP53RK, Nori-2, C20orf64, EC=3.6.-.-, EC=2.7.11.1, TP53-regulating kinase, p53-related protein kinase, EKC/KEOPS complex... |
| Anwendung: | WB |
| Exprimiert in: | Human |
497,00 €
Artikelnummer: 043147.200
Protein kinase that phosphorylates 'Ser-15' of p53/TP53 protein and may therefore participate in its activation. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid...
| Schlagworte: | Anti-TP53RK, Anti-Nori-2, Anti-C20orf64, EC=3.6.-.-, EC=2.7.11.1, Anti-TP53-regulating kinase, Anti-p53-related protein... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: P9120-90.200
Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism,...
| Schlagworte: | EC=2.7.11.1, Anti-TP53-regulating kinase, Anti-p53-related protein kinase |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
865,00 €
Artikelnummer: ATA-APrEST71455.100
Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
| Schlagworte: | Nori-2, C20orf64, TP53-regulating kinase, p53-related protein kinase, EKC/KEOPS complex subunit TP53RK, Atypical... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: G-CAB14952.20
Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
| Schlagworte: | Anti-Nori-2, Anti-C20orf64, Anti-TP53-regulating kinase, Anti-p53-related protein kinase, Anti-EKC/KEOPS complex subunit... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
103,00 €
Artikelnummer: CSB-CL822302HU.10
Length: 762 Sequence: atggcggcgg ccagagctac tacgccggcc gatggcgagg agcccgcccc ggaggctgag gctctggccg cagcccggga gcggagcagc cgcttcttga gcggcctgga gctggtgaag cagggtgccg aggcgcgcgt gttccgtggc cgcttccagg gccgcgcggc ggtgatcaag caccgcttcc ccaagggcta ccggcacccg gcgctggagg cgcggcttgg cagacggcgg acggtgcagg aggcccgggc...
| Schlagworte: | Nori-2, C20orf64, TP53-regulating kinase, p53-related protein kinase, EKC/KEOPS complex subunit TP53RK, Atypical... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
290,00 €
Artikelnummer: ABS-PP-12434.100
Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
| Schlagworte: | EKC/KEOPS complex subunit TP53RK, Atypical serine/threonine protein kinase TP53RK, Nori-2, TP53-regulating kinase,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 29 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95777.100
PrEST Antigen TP53RK, Gene description: TP53 regulating kinase, Alternative Gene Names: BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk, TPRKB, Antigen sequence: FGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Schlagworte: | Nori-2, C20orf64, TP53-regulating kinase, p53-related protein kinase, EKC/KEOPS complex subunit TP53RK, Atypical... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €