Zu "Q96PM9" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZNF385A
Artikelnummer: ATA-HPA076214.100
Polyclonal Antibody against Human ZNF385A, Gene description: zinc finger protein 385A, Alternative Gene Names: DKFZp586G1122, Hzf, ZFP385, ZNF385, Validated applications: ICC, WB, Uniprot ID: Q96PM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-HZF, Anti-ZNF385A, Anti-Zinc finger protein 385A, Anti-Retinal zinc finger protein, Anti-Hematopoietic zinc finger... |
| Anwendung: | WB, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-ZNF385A
Artikelnummer: ATA-HPA076214.25
Polyclonal Antibody against Human ZNF385A, Gene description: zinc finger protein 385A, Alternative Gene Names: DKFZp586G1122, Hzf, ZFP385, ZNF385, Validated applications: ICC, WB, Uniprot ID: Q96PM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-HZF, Anti-ZNF385A, Anti-Zinc finger protein 385A, Anti-Retinal zinc finger protein, Anti-Hematopoietic zinc finger... |
| Anwendung: | WB, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
ZNF385, Human, Real Time PCR Primer Set
Artikelnummer: VHPS-10262
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | HZF, ZNF385A, Zinc finger protein 385A, Retinal zinc finger protein, Hematopoietic zinc finger protein |
| Anwendung: | RNA quantification |
45,00 €
Anti-ZNF385A, NT (ZNF385A, HZF, RZF, ZNF385, Zinc finger...
Artikelnummer: 044214.200
Zinc finger proteins, such as ZNF385A, are regulatory proteins that act as transcription factors, bind single- or double-stranded RNA, or interact with other proteins (Sharma et al., 2004 [PubMed 15527981]). Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot:...
| Schlagworte: | Anti-HZF, Anti-ZNF385A, Anti-Zinc finger protein 385A, Anti-Retinal zinc finger protein, Anti-Hematopoietic zinc finger... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
ZNF385A (Vector Vector will be determined during the...
Artikelnummer: CSB-CL026710HU.10
Length: 1101 Sequence: atgcagcccc cactggacct caagcagatc ctgcccttcc cactcgagcc agcccctacc cttggcctct tcagcaacta cagcaccatg gaccctgtgc agaaggctgt gctctcccac acttttgggg gacccttgct caagaccaag cggcccgtca tttcctgtaa tatctgtcaa atccgcttca attctcagag ccaggctgag gcgcactaca aaggtaatcg ccacgcccga cgagtcaaag gcattgaggc...
| Schlagworte: | HZF, ZNF385A, Zinc finger protein 385A, Retinal zinc finger protein, Hematopoietic zinc finger protein |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
ZNF385A (human), recombinant protein
Artikelnummer: ABS-PP-9528.100
Protein function: RNA-binding protein that affects the localization and the translation of a subset of mRNA. May play a role in adipogenesis through binding to the 3'-UTR of CEBPA mRNA and regulation of its translation. Targets ITPR1 mRNA to dendrites in Purkinje cells, and may regulate its activity-dependent...
| Schlagworte: | Zinc finger protein 385A, Hematopoietic zinc finger protein, Retinal zinc finger protein, Recombinant Human ZNF385A Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 26 kD |
ab 90,00 €
ZNF385A PrEST Antigen
Artikelnummer: ATA-APrEST95774.100
PrEST Antigen ZNF385A, Gene description: zinc finger protein 385A, Alternative Gene Names: DKFZp586G1122, Hzf, ZFP385, ZNF385, Antigen sequence: PVSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGTPAPASLPGGSKEEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding protein...
| Schlagworte: | HZF, ZNF385A, Zinc finger protein 385A, Retinal zinc finger protein, Hematopoietic zinc finger protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
ZNF385A (human), recombinant protein
Artikelnummer: ABS-PP-9528-L.100
Protein function: RNA-binding protein that affects the localization and the translation of a subset of mRNA. May play a role in adipogenesis through binding to the 3'-UTR of CEBPA mRNA and regulation of its translation. Targets ITPR1 mRNA to dendrites in Purkinje cells, and may regulate its activity-dependent...
| Schlagworte: | Zinc finger protein 385A, Hematopoietic zinc finger protein, Retinal zinc finger protein, Recombinant Human ZNF385A Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 26 kD |
ab 115,00 €