Zu "Q96N77" wurden 8 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZNF641
Anti-ZNF641

Artikelnummer: ATA-HPA035189.100

Protein function: Transcriptional activator. Activates transcriptional activities of SRE and AP-1. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 73% and to rat: 71%
Schlagworte: Anti-ZNF641, Anti-Zinc finger protein 641
Anwendung: WB, IHC, ICC, ChIP
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
Anti-ZNF641
Anti-ZNF641

Artikelnummer: ATA-HPA075069.100

Polyclonal Antibody against Human ZNF641, Gene description: zinc finger protein 641, Alternative Gene Names: FLJ31295, Validated applications: ICC, Uniprot ID: Q96N77, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Transcriptional activator. Activates...
Schlagworte: Anti-ZNF641, Anti-Zinc finger protein 641
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
NEU
Anti-ZNF641
Anti-ZNF641

Artikelnummer: ATA-HPA075069.25

Polyclonal Antibody against Human ZNF641, Gene description: zinc finger protein 641, Alternative Gene Names: FLJ31295, Validated applications: ICC, Uniprot ID: Q96N77, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Transcriptional activator. Activates...
Schlagworte: Anti-ZNF641, Anti-Zinc finger protein 641
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
ZNF641 (human), recombinant protein
ZNF641 (human), recombinant protein

Artikelnummer: ABS-PP-2651-L.100

Protein function: Transcriptional activator. Activates transcriptional activities of SRE and AP-1. [The UniProt Consortium]
Schlagworte: Zinc finger protein 641, Recombinant Human ZNF641 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 15 kD
ab 115,00 €
Bewerten
ZNF641 PrEST Antigen
ZNF641 PrEST Antigen

Artikelnummer: ATA-APrEST83508.100

Protein function: Transcriptional activator. Activates transcriptional activities of SRE and AP-1. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: ZNF641, Zinc finger protein 641
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
ZNF641 (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
ZNF641 (Vector Vector will be determined during the...

Artikelnummer: CSB-CL026911HU.10

Length: 909 Sequence: atggcagctg cacttcttgc ggctggatca cagggcctgg taaccatcaa ggatgtgtca ctgtgcttct ctcaggagga gtggcggagc ctggacccct ctcagacaga cttttatgga gaatatgtca tgcaggaaaa ctgtgggata gtagtctctc tgagatttcc aattcccaaa ctggacatgc tttctcaact agaaggagga gaagaacaat gggtccctga cccccaggac ttagaggaga gggacattct...
Schlagworte: ZNF641, Zinc finger protein 641
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
176,00 €
Bewerten
ZNF641 (human), recombinant protein
ZNF641 (human), recombinant protein

Artikelnummer: ABS-PP-2651.100

Protein function: Transcriptional activator. Activates transcriptional activities of SRE and AP-1. [The UniProt Consortium]
Schlagworte: Zinc finger protein 641, Recombinant Human ZNF641 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 15 kD
ab 90,00 €
Bewerten
ZNF641 PrEST Antigen
ZNF641 PrEST Antigen

Artikelnummer: ATA-APrEST95709.100

PrEST Antigen ZNF641, Gene description: zinc finger protein 641, Alternative Gene Names: FLJ31295, Antigen sequence: DTVLWNPEHDESWDSMPSSSRGMLLGPPFLQEDSFSNLLCSTEMDSLLRPHTCPQCGKQFVW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcriptional activator. Activates...
Schlagworte: ZNF641, Zinc finger protein 641
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten