Zu "Q96BV0" wurden 5 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZNF775
Anti-ZNF775

Artikelnummer: ATA-HPA073171.100

Polyclonal Antibody against Human ZNF775, Gene description: zinc finger protein 775, Alternative Gene Names: MGC33584, Validated applications: IHC, Uniprot ID: Q96BV0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional...
Schlagworte: Anti-ZNF775, Anti-Zinc finger protein 775
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-ZNF775
Anti-ZNF775

Artikelnummer: ATA-HPA073171.25

Polyclonal Antibody against Human ZNF775, Gene description: zinc finger protein 775, Alternative Gene Names: MGC33584, Validated applications: IHC, Uniprot ID: Q96BV0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional...
Schlagworte: Anti-ZNF775, Anti-Zinc finger protein 775
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
Anti-ZNF775, CT (ZNF775, Zinc finger protein 775)
Anti-ZNF775, CT (ZNF775, Zinc finger protein 775)

Artikelnummer: 044361.200

ZNF775 may be involved in transcriptional regulation. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
Schlagworte: Anti-ZNF775, Anti-Zinc finger protein 775
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
Anti-ZN775
Anti-ZN775

Artikelnummer: ELK-ES12107.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Nucleus .
Schlagworte: Anti-ZNF775, Anti-Zinc finger protein 775, ZN775 rabbit pAb
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 173,00 €
Bewerten
ZNF775 PrEST Antigen
ZNF775 PrEST Antigen

Artikelnummer: ATA-APrEST96140.100

PrEST Antigen ZNF775, Gene description: zinc finger protein 775, Alternative Gene Names: MGC33584, Antigen sequence: GTGAGLVMKVKQEKPERLLQTLAPQAMLVEKDKENIFQQHRGLPPRQTMGRPRALGGQEESGSPRWAPPTEQDAGLAGRAPGSASGPLSPSLSSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be...
Schlagworte: ZNF775, Zinc finger protein 775
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten