Zu "Q96B45" wurden 10 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-BORCS7
Artikelnummer: ATA-HPA037648.100
Protein function: As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. [The UniProt Consortium] Buffer: 40%...
| Schlagworte: | Anti-Diaskedin, Anti-BLOC-1-related complex subunit 7 |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-BORCS7
Artikelnummer: ATA-HPA077528.100
Polyclonal Antibody against Human BORCS7, Gene description: BLOC-1 related complex subunit 7, Alternative Gene Names: C10orf32, FLJ40752, Validated applications: ICC, Uniprot ID: Q96B45, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: As part of the BORC...
| Schlagworte: | Anti-Diaskedin, Anti-BLOC-1-related complex subunit 7 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
BORCS7 PrEST Antigen
Artikelnummer: ATA-APrEST80363.100
Protein function: As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. [The UniProt Consortium] Buffer: PBS and...
| Schlagworte: | Diaskedin, BLOC-1-related complex subunit 7 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-C10orf32
Artikelnummer: G-CAB7276.20
Protein function: As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. [The UniProt Consortium]
| Schlagworte: | Anti-Diaskedin, Anti-BLOC-1-related complex subunit 7 |
| Anwendung: | WB, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
103,00 €
C10orf32 (Vector Vector will be determined during the...
Artikelnummer: CSB-CL842639HU.10
Length: 318 Sequence: atggcgactg gaacgccaga gtctcaagcg cggttcggtc agtccgtgaa ggggcttctc acggagaagg tgaccacctg tggtactgac gtaatcgcgc tcaccaagca ggtgctgaaa ggctcccgga gctccgagct gctaggtcag gcagctcgaa acatggtact ccaggaagat gccatcttgc actcagaaga tagtttaagg aagatggcaa taataacaac acatcttcaa taccagcaag aagctattca...
| Schlagworte: | Diaskedin, BLOC-1-related complex subunit 7 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Anti-BORCS7
Artikelnummer: CSB-PA842639LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: BORCS7. Antigen Species: Human
| Schlagworte: | Anti-Diaskedin, Anti-BLOC-1-related complex subunit 7, BORCS7 antibody, C10orf32BLOC-1-related complex subunit 7 antibody,... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-BORCS7, HRP conjugated
Artikelnummer: CSB-PA842639LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: BORCS7. Antigen Species: Human
| Schlagworte: | Anti-Diaskedin, Anti-BLOC-1-related complex subunit 7, BORCS7 antibody, C10orf32BLOC-1-related complex subunit 7 antibody,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-BORCS7, FITC conjugated
Artikelnummer: CSB-PA842639LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: BORCS7. Antigen Species: Human
| Schlagworte: | Anti-Diaskedin, Anti-BLOC-1-related complex subunit 7, BORCS7 antibody, C10orf32BLOC-1-related complex subunit 7 antibody,... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-BORCS7, Biotin conjugated
Artikelnummer: CSB-PA842639LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: BORCS7. Antigen Species: Human
| Schlagworte: | Anti-Diaskedin, Anti-BLOC-1-related complex subunit 7, BORCS7 antibody, C10orf32BLOC-1-related complex subunit 7 antibody,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
BORCS7 PrEST Antigen
Artikelnummer: ATA-APrEST95857.100
PrEST Antigen BORCS7, Gene description: BLOC-1 related complex subunit 7, Alternative Gene Names: C10orf32, FLJ40752, Antigen sequence: ARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: As part of the BORC complex may...
| Schlagworte: | Diaskedin, BLOC-1-related complex subunit 7 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €