Zu "Q96AP4" wurden 11 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZUFSP
Anti-ZUFSP

Artikelnummer: ATA-HPA044426.100

Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
Schlagworte: Anti-DUB, Anti-C6orf113, Anti-Lys-63-specific deubiquitinase ZUFSP, Anti-Zinc finger-containing ubiquitin peptidase 1,...
Anwendung: ICC, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 330,00 €
Bewerten
Anti-ZUP1
Anti-ZUP1

Artikelnummer: ATA-HPA076940.100

Polyclonal Antibody against Human ZUP1, Gene description: zinc finger containing ubiquitin peptidase 1, Alternative Gene Names: C6orf113, dJ412I7.3, ZUFSP, Validated applications: ICC, Uniprot ID: Q96AP4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Schlagworte: Anti-DUB, Anti-C6orf113, Anti-Lys-63-specific deubiquitinase ZUFSP, Anti-Zinc finger-containing ubiquitin peptidase 1,...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-ZUP1
Anti-ZUP1

Artikelnummer: ATA-HPA076940.25

Polyclonal Antibody against Human ZUP1, Gene description: zinc finger containing ubiquitin peptidase 1, Alternative Gene Names: C6orf113, dJ412I7.3, ZUFSP, Validated applications: ICC, Uniprot ID: Q96AP4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Schlagworte: Anti-DUB, Anti-C6orf113, Anti-Lys-63-specific deubiquitinase ZUFSP, Anti-Zinc finger-containing ubiquitin peptidase 1,...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
C6orf113, Human, Real Time PCR Primer Set
C6orf113, Human, Real Time PCR Primer Set

Artikelnummer: VHPS-1324

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: ZUFSP, C6orf113, Zinc finger with UFM1-specific peptidase domain protein
Anwendung: RNA quantification
45,00 €
Bewerten
Anti-ZUFSP, NT (ZUFSP, C6orf113, Zinc finger with UFM1-specific peptidase domain protein)
Anti-ZUFSP, NT (ZUFSP, C6orf113, Zinc finger with...

Artikelnummer: 044425.200

Applications:, Suitable for use in Western Blot and ELISA. Other applications have not been tested. , Recommended Dilution: Western Blot: 1:1000, Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing....
Schlagworte: Anti-ZUFSP, Anti-C6orf113, Anti-Zinc finger with UFM1-specific peptidase domain protein
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: hamster, human, mouse
865,00 €
Bewerten
ZUFSP PrEST Antigen
ZUFSP PrEST Antigen

Artikelnummer: ATA-APrEST70192.100

Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
Schlagworte: DUB, C6orf113, Lys-63-specific deubiquitinase ZUFSP, Zinc finger-containing ubiquitin peptidase 1, Zinc finger with...
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-ZUFSP
Anti-ZUFSP

Artikelnummer: ELK-ES12066.100

Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
Schlagworte: Anti-DUB, Anti-C6orf113, Anti-Lys-63-specific deubiquitinase ZUFSP, Anti-Zinc finger-containing ubiquitin peptidase 1,...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 173,00 €
Bewerten
ZUFSP (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
ZUFSP (Vector Vector will be determined during the...

Artikelnummer: CSB-CL853384HU.10

Length: 1737 Sequence: atgctttcct gtaatatttg tggtgaaaca gtaacctcag aaccagacat gaaagctcac ctaattgttc acatggaaag tgaaattata tgtccatttt gcaagttgtc aggtgtgaat tatgatgaaa tgtgttttca tatcgaaaca gctcattttg agcagaatac acttgaaaga aactttgaga ggataaatac agtacaatat ggaacttcag ataacaagaa agacaacacc ctacagtgtg gaatggaagt...
Schlagworte: DUB, C6orf113, Lys-63-specific deubiquitinase ZUFSP, Zinc finger-containing ubiquitin peptidase 1, Zinc finger with...
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
357,00 €
Bewerten
ZUP1 (human), recombinant protein
ZUP1 (human), recombinant protein

Artikelnummer: ABS-PP-9546.100

Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
Schlagworte: Zinc finger-containing ubiquitin peptidase 1, Lys-63-specific deubiquitinase ZUFSP, DUB, Zinc finger with UFM1-specific...
Exprimiert in: E.coli
Ursprungsart: human
MW: 31 kD
ab 90,00 €
Bewerten
ZUP1 PrEST Antigen
ZUP1 PrEST Antigen

Artikelnummer: ATA-APrEST95798.100

PrEST Antigen ZUP1, Gene description: zinc finger containing ubiquitin peptidase 1, Alternative Gene Names: C6orf113, dJ412I7.3, ZUFSP, Antigen sequence: TSKPPIYLQHQGHSRTVIGIEEKKNRTLCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEGALSLEEKLARRQASQVFTA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Schlagworte: DUB, C6orf113, Lys-63-specific deubiquitinase ZUFSP, Zinc finger-containing ubiquitin peptidase 1, Zinc finger with...
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
ZUP1 (human), recombinant protein
ZUP1 (human), recombinant protein

Artikelnummer: ABS-PP-9546-L.100

Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
Schlagworte: Zinc finger-containing ubiquitin peptidase 1, Lys-63-specific deubiquitinase ZUFSP, DUB, Zinc finger with UFM1-specific...
Exprimiert in: E.coli
Ursprungsart: human
MW: 31 kD
ab 115,00 €
Bewerten