Zu "Q969Q0" wurden 16 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-RPL36AL
Anti-RPL36AL

Artikelnummer: ARG40081.100

Schlagworte: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
707,00 €
Bewerten
60S ribosomal protein L36a-like (RPL36AL), human, recombinant
60S ribosomal protein L36a-like (RPL36AL), human,...

Artikelnummer: CSB-RP018044h.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-106aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MVNVPKTRRT FCKKCGKHQP HKVTQYKKGK DSLYAQGRRR YDRKQSGYGG QTKPIFRKKA KTTKKIVLRL ECVEPNCRSK RMLAIKRCKH FELGGDKKRK GQVIQF. Purity: Greater than 90% as...
Schlagworte: RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like, Recombinant Human 60S ribosomal...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 39.5 kD
ab 219,00 €
Bewerten
Anti-RPL36AL
Anti-RPL36AL

Artikelnummer: CSB-PA01804A0Rb.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
Schlagworte: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-RPL36AL
Anti-RPL36AL

Artikelnummer: CSB-PA01805A0Rb.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
Schlagworte: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
RPL36AL (human), recombinant protein
RPL36AL (human), recombinant protein

Artikelnummer: ABS-PP-10782-L.100

Schlagworte: Ribosomal protein eL42-like, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like, Recombinant Human...
Exprimiert in: E.coli
Ursprungsart: human
MW: 13 kD
ab 115,00 €
Bewerten
RPL36AL, Recombinant, Human, aa1-106, GST-Tag (60S Ribosomal Protein L36a-like)
RPL36AL, Recombinant, Human, aa1-106, GST-Tag (60S...

Artikelnummer: 375106.1

Belongs to the ribosomal protein L44e family. Source: Recombinant protein corresponding to aa1-106 from RPL36AL, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.5kD, AA Sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF,...
Schlagworte: RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like
MW: 39,5
ab 603,00 €
Bewerten
Anti-RPL36AL
Anti-RPL36AL

Artikelnummer: G-CAB14366.20

RPL36AL Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in WB IF applications.RPL36AL Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
Schlagworte: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like
Anwendung: WB, IF
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
103,00 €
Bewerten
Anti-RL36L
Anti-RL36L

Artikelnummer: ELK-ES9327.100

Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The...
Schlagworte: Anti-RPL36AL, Anti-Ribosomal protein eL42-like, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein...
Anwendung: WB, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, rat, mouse,
ab 173,00 €
Bewerten
Anti-RPL36AL, HRP conjugated
Anti-RPL36AL, HRP conjugated

Artikelnummer: CSB-PA01804B0Rb.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
Schlagworte: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-RPL36AL, FITC conjugated
Anti-RPL36AL, FITC conjugated

Artikelnummer: CSB-PA01804C0Rb.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
Schlagworte: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S...
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-RPL36AL, Biotin conjugated
Anti-RPL36AL, Biotin conjugated

Artikelnummer: CSB-PA01804D0Rb.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
Schlagworte: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-RPL36AL, HRP conjugated
Anti-RPL36AL, HRP conjugated

Artikelnummer: CSB-PA01805B0Rb.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
Schlagworte: Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
1 von 2 Seiten