Zu "Q920H1" wurden 4 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Scgb3A2, Mouse secretoglobin, family 3A, member 2, Real Time PCR Primer Set
Scgb3A2, Mouse secretoglobin, family 3A, member 2, Real...

Artikelnummer: VMPS-5698

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2
Anwendung: RNA quantification
43,00 €
Bewerten
Anti-Scgb3a2
Anti-Scgb3a2

Artikelnummer: G-PACO39234.50

Scgb3a2 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse and for use in ELISA applications. Scgb3a2 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Secreted cytokine-like protein. Binds to the scavenger receptor MARCO. Can also bind to...
Schlagworte: Anti-Pnsp1, Anti-PnSP-1, Anti-Scgb3a2, Anti-Pneumo secretory protein 1, Anti-Uteroglobin-related protein 1,...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: mouse
363,00 €
Bewerten
Scgb3a2, Recombinant, Mouse, aa22-139, His-GST-Tag (Secretoglobin Family 3A Member 2)
Scgb3a2, Recombinant, Mouse, aa22-139, His-GST-Tag...

Artikelnummer: 375219.100

Enzyme and pathway databases. Source: Recombinant protein corresponding to aa22-139 from mouse Scgb3a2, fused to His-GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.2kD, AA Sequence:...
Schlagworte: Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2
MW: 43,2
ab 575,00 €
Bewerten
Scgb3a2, Recombinant, Mouse, aa22-139, His-Tag (Secretoglobin Family 3A Member 2)
Scgb3a2, Recombinant, Mouse, aa22-139, His-Tag...

Artikelnummer: 375220.100

Source:, Recombinant protein corresponding to aa22-139 from mouse Scgb3a2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.2kD, AA Sequence: LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL, Storage and Stability: May be...
Schlagworte: Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2
MW: 15,2
ab 621,00 €
Bewerten