- Suchergebnis für Q8NHS3
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q8NHS3" wurden 11 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA044802.100
Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 66% and to rat: 66%
| Schlagworte: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 330,00 €
Artikelnummer: G-PACO39166.50
MFSD8 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. MFSD8 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The...
| Schlagworte: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
313,00 €
Artikelnummer: CSB-EP844087HU1.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-40aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: MAGLRNESEQ EPLLGDTPGS REWDILETEE HYKSRWRSIR. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological Activity: n/a. Form:...
| Schlagworte: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8,... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 34.8 kD |
ab 292,00 €
Artikelnummer: 374200.100
May be a carrier that transport small solutes by using chemiosmotic ion gradients. Source: Recombinant protein corresponding to aa1-40 from human MFSD8, fused to His-GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~34.8kD, AA Sequence: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR, Storage and Stability:...
| Schlagworte: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8 |
| MW: | 34,8 |
ab 690,00 €
Artikelnummer: ATA-APrEST84093.100
Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ELK-ES11413.100
This gene encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The...
| Schlagworte: | Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing protein 8, MFSD8... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
Artikelnummer: CSB-CL844087HU.10
Length: 1557 Sequence: atggccggcc tgcggaacga aagtgaacag gagccgctct taggcgacac acctggaagc agagaatggg acattttaga gactgaagag cattataaga gccgatggag atctattagg attttatatc ttactatgtt tctcagcagt gtagggtttt ctgtagtgat gatgtccata tggccatatc tccaaaagat tgatccgaca gctgatacaa gttttttggg ctgggttatt gcttcatata gtcttggcca...
| Schlagworte: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
357,00 €
Artikelnummer: CSB-PA844087LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Schlagworte: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA844087LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Schlagworte: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA844087LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Schlagworte: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA844087LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Schlagworte: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €