Zu "Q8NHS3" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MFSD8
Artikelnummer: ATA-HPA044802.100
Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 66% and to rat: 66%
| Schlagworte: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 330,00 €
Anti-MFSD8
Artikelnummer: G-PACO39166.50
MFSD8 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. MFSD8 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The...
| Schlagworte: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
313,00 €
Major facilitator superfamily domain-containing protein 8...
Artikelnummer: CSB-EP844087HU1.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-40aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: MAGLRNESEQ EPLLGDTPGS REWDILETEE HYKSRWRSIR. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological Activity: n/a. Form:...
| Schlagworte: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8,... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 34.8 kD |
ab 292,00 €
MFSD8, Recombinant, Human, aa1-40, His-GST-Tag (Major...
Artikelnummer: 374200.100
May be a carrier that transport small solutes by using chemiosmotic ion gradients. Source: Recombinant protein corresponding to aa1-40 from human MFSD8, fused to His-GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~34.8kD, AA Sequence: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR, Storage and Stability:...
| Schlagworte: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8 |
| MW: | 34,8 |
ab 690,00 €
MFSD8 PrEST Antigen
Artikelnummer: ATA-APrEST84093.100
Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-MFSD8
Artikelnummer: ELK-ES11413.100
This gene encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The...
| Schlagworte: | Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing protein 8, MFSD8... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
MFSD8 (Vector Vector will be determined during the...
Artikelnummer: CSB-CL844087HU.10
Length: 1557 Sequence: atggccggcc tgcggaacga aagtgaacag gagccgctct taggcgacac acctggaagc agagaatggg acattttaga gactgaagag cattataaga gccgatggag atctattagg attttatatc ttactatgtt tctcagcagt gtagggtttt ctgtagtgat gatgtccata tggccatatc tccaaaagat tgatccgaca gctgatacaa gttttttggg ctgggttatt gcttcatata gtcttggcca...
| Schlagworte: | CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
357,00 €
Anti-MFSD8
Artikelnummer: CSB-PA844087LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Schlagworte: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-MFSD8, HRP conjugated
Artikelnummer: CSB-PA844087LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Schlagworte: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-MFSD8, FITC conjugated
Artikelnummer: CSB-PA844087LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Schlagworte: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-MFSD8, Biotin conjugated
Artikelnummer: CSB-PA844087LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
| Schlagworte: | Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €