Zu "Q8NAP8" wurden 8 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZBTB8B
Anti-ZBTB8B

Artikelnummer: ATA-HPA055553.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 84% and to rat: 88%
Schlagworte: Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
Anti-ZBTB8B
Anti-ZBTB8B

Artikelnummer: ATA-HPA071427.100

Polyclonal Antibody against Human ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Validated applications: ICC, Uniprot ID: Q8NAP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Schlagworte: Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
NEU
Anti-ZBTB8B
Anti-ZBTB8B

Artikelnummer: ATA-HPA071427.25

Polyclonal Antibody against Human ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Validated applications: ICC, Uniprot ID: Q8NAP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Schlagworte: Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
ZBTB8B (human), recombinant protein
ZBTB8B (human), recombinant protein

Artikelnummer: ABS-PP-3613-L.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
Schlagworte: Zinc finger and BTB domain-containing protein 8B, Recombinant Human ZBTB8B Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 11.5 kD
ab 115,00 €
Bewerten
Anti-ZBTB8B, CT (ZBTB8B, Zinc finger and BTB domain-containing protein 8B)
Anti-ZBTB8B, CT (ZBTB8B, Zinc finger and BTB...

Artikelnummer: 044011.200

ZBTB8B may be involved in transcriptional regulation. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
Schlagworte: Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
ZBTB8B PrEST Antigen
ZBTB8B PrEST Antigen

Artikelnummer: ATA-APrEST89159.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: ZBTB8B, Zinc finger and BTB domain-containing protein 8B
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
ZBTB8B (human), recombinant protein
ZBTB8B (human), recombinant protein

Artikelnummer: ABS-PP-3613.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
Schlagworte: Zinc finger and BTB domain-containing protein 8B, Recombinant Human ZBTB8B Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 11.5 kD
ab 90,00 €
Bewerten
ZBTB8B PrEST Antigen
ZBTB8B PrEST Antigen

Artikelnummer: ATA-APrEST95606.100

PrEST Antigen ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Antigen sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Schlagworte: ZBTB8B, Zinc finger and BTB domain-containing protein 8B
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten