- Suchergebnis für Q8N5C7
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q8N5C7" wurden 18 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: G-PACO26353.50
DTWD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. DTWD1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20 in...
| Schlagworte: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1 |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
313,00 €
Artikelnummer: ATA-HPA042214.100
Protein function: Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20 in the D-loop of several cytoplasmic tRNAs (acp3U(20)). [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 87%...
| Schlagworte: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1 |
| Anwendung: | ICC, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: CSB-EP007219HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-109aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MSLNPPIFLK RSEENSSKFV ETKQSQTTSI ASEDPLQNLC LASQEVLQKA QQSGRSKCLK CGGSRMFYCY TCYVPVENVP IEQIPLVKLP LKIDIIKHPN ETDGKSTAI. Purity: Greater than 90% as...
| Schlagworte: | DTW domain-containing protein 1, tRNA-uridine aminocarboxypropyltransferase 1, Recombinant Human DTW domain-containing... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 39.2 kD |
ab 219,00 €
Artikelnummer: VHPS-5634
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | DTWD1, MDS009, DTW domain-containing protein 1 |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: 034838.200
Applications:, Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product,...
| Schlagworte: | Anti-DTWD1, Anti-MDS009, Anti-DTW domain-containing protein 1 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: 373105.1
Source:, Recombinant protein corresponding to aa1-109 from human DTWD1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.2kD, AA Sequence: MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAI, Storage and Stability: May be stored...
| Schlagworte: | DTWD1, MDS009, DTW domain-containing protein 1 |
| MW: | 39,2 |
ab 603,00 €
Artikelnummer: ATA-APrEST82659.100
Protein function: Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20 in the D-loop of several cytoplasmic tRNAs (acp3U(20)). [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | DTW domain-containing protein 1, tRNA-uridine aminocarboxypropyltransferase 1 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ELK-ES16884.100
Protein function: Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20 in the D-loop of several cytoplasmic tRNAs (acp3U(20)). [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Nucleus .
| Schlagworte: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1, DTWD1 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
Artikelnummer: CSB-CL839801HU1.10
Length: 915 Sequence: atgtctctca atccacctat atttctcaaa cgaagtgaag aaaatagttc aaaatttgtg gaaacaaaac agtcacaaac tacttccata gcttcagaag atccccttca aaacttatgt ttagcatctc aagaagttct tcaaaaagct cagcaaagtg ggagatcaaa atgtctcaaa tgtggtggtt ccagaatgtt ctactgctat acatgttatg ttccagttga aaatgtacct attgaacaga ttccacttgt...
| Schlagworte: | DTW domain-containing protein 1, tRNA-uridine aminocarboxypropyltransferase 1 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Artikelnummer: CSB-CL839801HU2.10
Length: 330 Sequence: atgtctctca atccacctat atttctcaaa cgaagtgaag aaaatagttc aaaatttgtg gaaacaaaac agtcacaaac tacttccata gcttcagaag atccccttca aaacttatgt ttagcatctc aagaagttct tcaaaaagct cagcaaagtg ggagatcaaa atgtctcaaa tgtggtggtt ccagaatgtt ctactgctat acatgttatg ttccagttga aaatgtacct attgaacaga ttccacttgt...
| Schlagworte: | DTW domain-containing protein 1, tRNA-uridine aminocarboxypropyltransferase 1 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Artikelnummer: CSB-PA007219EA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: DTWD1. Antigen Species: Human
| Schlagworte: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1, DTW domain containing 1 antibody,... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA007219EC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: DTWD1. Antigen Species: Human
| Schlagworte: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1, DTW domain containing 1 antibody,... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €