Zu "Q8N2E2" wurden 7 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-VWDE
Artikelnummer: ATA-HPA026619.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 90% and to rat: 87%
| Schlagworte: | Anti-VWDE, Anti-von Willebrand factor D and EGF domain-containing protein |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-VWDE
Artikelnummer: ATA-HPA036044.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 69% and to rat: 69%
| Schlagworte: | Anti-VWDE, Anti-von Willebrand factor D and EGF domain-containing protein |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-VWDE
Artikelnummer: ATA-HPA036045.100
Polyclonal Antibody against Human VWDE, Gene description: von Willebrand factor D and EGF domains, Alternative Gene Names: FLJ14712, Validated applications: ICC, Uniprot ID: Q8N2E2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 56% Rat gene identity: 56%
| Schlagworte: | Anti-VWDE, Anti-von Willebrand factor D and EGF domain-containing protein |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Anti-VWDE
Artikelnummer: ATA-HPA036045.25
Polyclonal Antibody against Human VWDE, Gene description: von Willebrand factor D and EGF domains, Alternative Gene Names: FLJ14712, Validated applications: ICC, Uniprot ID: Q8N2E2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 56% Rat gene identity: 56%
| Schlagworte: | Anti-VWDE, Anti-von Willebrand factor D and EGF domain-containing protein |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
VWDE PrEST Antigen
Artikelnummer: ATA-APrEST70181.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | VWDE, von Willebrand factor D and EGF domain-containing protein |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
VWDE PrEST Antigen
Artikelnummer: ATA-APrEST74997.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | VWDE, von Willebrand factor D and EGF domain-containing protein |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
VWDE PrEST Antigen
Artikelnummer: ATA-APrEST95602.100
PrEST Antigen VWDE, Gene description: von Willebrand factor D and EGF domains, Alternative Gene Names: FLJ14712, Antigen sequence: LLTTQQITVRLNDDCDAETRVTIEVTVKSCDCLNGGSCVSDRNFSPGSGVYLCVCLPGFHGSLCEVDISGCQSNPCGLGSYISGFHSYSCDCPPELKVETQFVNQFTTQTVVLTRSDKSVN, Storage: Upon delivery store at -20°C. Avoid repeated...
| Schlagworte: | VWDE, von Willebrand factor D and EGF domain-containing protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €