Zu "Q8N142" wurden 16 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ADSS1
Artikelnummer: ATA-HPA052621.100
Polyclonal Antibody against Human ADSS1, Gene description: adenylosuccinate synthase 1, Alternative Gene Names: ADSSL1, FLJ38602, Validated applications: IHC, Uniprot ID: Q8N142, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of the purine...
| Schlagworte: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-M-type adenylosuccinate synthetase,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-ADSS1
Artikelnummer: ATA-HPA052621.25
Polyclonal Antibody against Human ADSS1, Gene description: adenylosuccinate synthase 1, Alternative Gene Names: ADSSL1, FLJ38602, Validated applications: IHC, Uniprot ID: Q8N142, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of the purine...
| Schlagworte: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-M-type adenylosuccinate synthetase,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Anti-ADSSL1, NT (ADSSL1, ADSS1, Adenylosuccinate...
Artikelnummer: 031666-FITC.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, FLISA, Recommended Dilution: FLISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated...
| Schlagworte: | Anti-ADSS1, Anti-AdSS 1, Anti-ADSSL1, Anti-AMPSase 1, EC=6.3.4.4, Anti-IMP--aspartate ligase 1, Anti-M-type... |
| Anwendung: | FLISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
1.104,00 €
Anti-ADSSL1, NT (ADSSL1, ADSS1, Adenylosuccinate...
Artikelnummer: 031666.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
| Schlagworte: | Anti-ADSS1, Anti-AdSS 1, Anti-ADSSL1, Anti-AMPSase 1, EC=6.3.4.4, Anti-IMP--aspartate ligase 1, Anti-M-type... |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
865,00 €
Anti-PURA1
Artikelnummer: ELK-ES13857.100
This gene encodes a member of the adenylosuccinate synthase family of proteins. The encoded muscle-specific enzyme plays a role in the purine nucleotide cycle by catalyzing the first step in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP). Mutations in this gene may cause adolescent...
| Schlagworte: | Anti-AdSSL1, Anti-AdSS 1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
ADSSL1 (Vector pUC, Accession No. BC047904)
Artikelnummer: CSB-CL836641HU.10
Length: 1374 Sequence: atgtcgggga cccgagcctc caacgaccgg ccccccggcg caggcggcgt caagcggggg cggctgcagc aggaggcggc ggcgaccggc tcccgcgtga cggtggtgct gggcgcgcag tggggggacg agggcaaagg caaggtggtg gacctgctgg ccacggacgc cgacatcatc agccgctgcc aggggggcaa caacgccggc cacacggtgg tggtggatgg gaaagagtac gacttccacc tgctgcccag...
| Schlagworte: | AdSS 1, AdSSL1, AMPSase 1, IMP--aspartate ligase 1, M-type adenylosuccinate synthetase, Adenylosuccinate synthetase-like... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
508,00 €
ADSS1 (human), recombinant protein
Artikelnummer: ABS-PP-4164.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Schlagworte: | Adenylosuccinate synthetase isozyme 1, AMPSase 1, AdSS 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 51.5 kD |
ab 90,00 €
ADSS1 PrEST Antigen
Artikelnummer: ATA-APrEST95780.100
PrEST Antigen ADSS1, Gene description: adenylosuccinate synthase 1, Alternative Gene Names: ADSSL1, FLJ38602, Antigen sequence: DILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENHVGVAVKWVGVG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of...
| Schlagworte: | AdSSL1, AdSS 1, AMPSase 1, IMP--aspartate ligase 1, Adenylosuccinate synthetase-like 1, M-type adenylosuccinate... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-ADSS1
Artikelnummer: ABS-KC-33820.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Schlagworte: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Anwendung: | WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Anti-ADSS1
Artikelnummer: ABS-KC-34418.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Schlagworte: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Anwendung: | WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Anti-ADSS1
Artikelnummer: ABS-KC-35080.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Schlagworte: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Anwendung: | WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Anti-ADSS1
Artikelnummer: ABS-KC-34953.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Schlagworte: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €