- Suchergebnis für Q8N142
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q8N142" wurden 16 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA052621.100
Polyclonal Antibody against Human ADSS1, Gene description: adenylosuccinate synthase 1, Alternative Gene Names: ADSSL1, FLJ38602, Validated applications: IHC, Uniprot ID: Q8N142, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of the purine...
| Schlagworte: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-M-type adenylosuccinate synthetase,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA052621.25
Polyclonal Antibody against Human ADSS1, Gene description: adenylosuccinate synthase 1, Alternative Gene Names: ADSSL1, FLJ38602, Validated applications: IHC, Uniprot ID: Q8N142, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of the purine...
| Schlagworte: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-M-type adenylosuccinate synthetase,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: 031666-FITC.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, FLISA, Recommended Dilution: FLISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated...
| Schlagworte: | Anti-ADSS1, Anti-AdSS 1, Anti-ADSSL1, Anti-AMPSase 1, EC=6.3.4.4, Anti-IMP--aspartate ligase 1, Anti-M-type... |
| Anwendung: | FLISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
1.104,00 €
Artikelnummer: 031666.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
| Schlagworte: | Anti-ADSS1, Anti-AdSS 1, Anti-ADSSL1, Anti-AMPSase 1, EC=6.3.4.4, Anti-IMP--aspartate ligase 1, Anti-M-type... |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
865,00 €
Artikelnummer: ELK-ES13857.100
This gene encodes a member of the adenylosuccinate synthase family of proteins. The encoded muscle-specific enzyme plays a role in the purine nucleotide cycle by catalyzing the first step in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP). Mutations in this gene may cause adolescent...
| Schlagworte: | Anti-AdSSL1, Anti-AdSS 1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
Artikelnummer: CSB-CL836641HU.10
Length: 1374 Sequence: atgtcgggga cccgagcctc caacgaccgg ccccccggcg caggcggcgt caagcggggg cggctgcagc aggaggcggc ggcgaccggc tcccgcgtga cggtggtgct gggcgcgcag tggggggacg agggcaaagg caaggtggtg gacctgctgg ccacggacgc cgacatcatc agccgctgcc aggggggcaa caacgccggc cacacggtgg tggtggatgg gaaagagtac gacttccacc tgctgcccag...
| Schlagworte: | AdSS 1, AdSSL1, AMPSase 1, IMP--aspartate ligase 1, M-type adenylosuccinate synthetase, Adenylosuccinate synthetase-like... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
508,00 €
Artikelnummer: ABS-PP-4164.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Schlagworte: | Adenylosuccinate synthetase isozyme 1, AMPSase 1, AdSS 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 51.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95780.100
PrEST Antigen ADSS1, Gene description: adenylosuccinate synthase 1, Alternative Gene Names: ADSSL1, FLJ38602, Antigen sequence: DILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENHVGVAVKWVGVG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of...
| Schlagworte: | AdSSL1, AdSS 1, AMPSase 1, IMP--aspartate ligase 1, Adenylosuccinate synthetase-like 1, M-type adenylosuccinate... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-KC-33820.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Schlagworte: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Anwendung: | WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Artikelnummer: ABS-KC-34418.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Schlagworte: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Anwendung: | WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Artikelnummer: ABS-KC-35080.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Schlagworte: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Anwendung: | WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Artikelnummer: ABS-KC-34953.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Schlagworte: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €