Zu "Q86YR7" wurden 12 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MCF2L2
Artikelnummer: ATA-HPA038946.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 30% and to rat: 29%
| Schlagworte: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-MCF2L2
Artikelnummer: ATA-HPA038947.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 28% and to rat: 28%
| Schlagworte: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-MCF2L2
Artikelnummer: ABS-KC-2717.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Schlagworte: | Anti-Probable guanine nucleotide exchange factor MCF2L2, Anti-Dbs-related Rho family guanine nucleotide exchange factor,... |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Anti-MCF2L2
Artikelnummer: ABS-KC-2724.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Schlagworte: | Anti-Probable guanine nucleotide exchange factor MCF2L2, Anti-Dbs-related Rho family guanine nucleotide exchange factor,... |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Anti-MCF2L2
Artikelnummer: ATA-HPA061485.100
Polyclonal Antibody against Human MCF2L2, Gene description: MCF.2 cell line derived transforming sequence-like 2, Alternative Gene Names: ARHGEF22, KIAA0861, Validated applications: ICC, Uniprot ID: Q86YR7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-MCF2L2
Artikelnummer: ABS-KC-17179.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Schlagworte: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
MCF2L2 (human), recombinant protein
Artikelnummer: ABS-PP-9046-L.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Schlagworte: | Probable guanine nucleotide exchange factor MCF2L2, Dbs-related Rho family guanine nucleotide exchange factor,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 58.5 kD |
ab 115,00 €
MCF2L2 PrEST Antigen
Artikelnummer: ATA-APrEST79286.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | DRG, MCF2L2, MCF2-transforming sequence-like protein 2, Probable guanine nucleotide exchange factor MCF2L2, Dbs-related... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
MCF2L2 PrEST Antigen
Artikelnummer: ATA-APrEST79287.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | DRG, MCF2L2, MCF2-transforming sequence-like protein 2, Probable guanine nucleotide exchange factor MCF2L2, Dbs-related... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-MF2L2
Artikelnummer: ELK-ES19613.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular localization:
| Schlagworte: | Anti-MCF2L2, Anti-ARHGEF22, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
MCF2L2 (human), recombinant protein
Artikelnummer: ABS-PP-9046.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Schlagworte: | Probable guanine nucleotide exchange factor MCF2L2, Dbs-related Rho family guanine nucleotide exchange factor,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 58.5 kD |
ab 90,00 €
MCF2L2 PrEST Antigen
Artikelnummer: ATA-APrEST95865.100
PrEST Antigen MCF2L2, Gene description: MCF.2 cell line derived transforming sequence-like 2, Alternative Gene Names: ARHGEF22, KIAA0861, Antigen sequence: MLSTEDLLMSHTRQRDKLQDELKLLGKQGTTLLSCIQEPATKCPNSKLNLNQLENVTTMERLLVQLDETEKAFSHFWSEHHLKLNQCLQLQHFEHDF, Storage: Upon delivery store at -20°C. Avoid repeated...
| Schlagworte: | DRG, MCF2L2, MCF2-transforming sequence-like protein 2, Probable guanine nucleotide exchange factor MCF2L2, Dbs-related... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €