Zu "Q86W56" wurden 28 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-PARG
Artikelnummer: ATA-HPA041247.100
Polyclonal Antibody against Human PARG, Gene description: poly(ADP-ribose) glycohydrolase, Validated applications: ICC, Uniprot ID: Q86W56, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Poly(ADP-ribose) glycohydrolase that degrades poly(ADP- ribose) by...
| Schlagworte: | Anti-Poly(ADP-ribose) glycohydrolase |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
Anti-PARG
Artikelnummer: A305-405A
Protein function: Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase (PubMed:23102699). PARG acts both as an endo- and exoglycosidase, releasing PAR of different length as well as ADP- ribose monomers (PubMed:23102699). Required for...
| Schlagworte: | Anti-PARG, EC=3.2.1.143, Anti-Poly(ADP-ribose) glycohydrolase |
| Anwendung: | WB, IP |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 178,00 €
Anti-PARG
Artikelnummer: A305-410A
Protein function: Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase (PubMed:23102699). PARG acts both as an endo- and exoglycosidase, releasing PAR of different length as well as ADP- ribose monomers (PubMed:23102699). Required for...
| Schlagworte: | Anti-PARG, EC=3.2.1.143, Anti-Poly(ADP-ribose) glycohydrolase |
| Anwendung: | WB, IP |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 178,00 €
Anti-PARG
Artikelnummer: ARG40973.100
Protein function: Poly(ADP-ribose) glycohydrolase that degrades poly(ADP- ribose) by hydrolyzing the ribose-ribose bonds present in poly(ADP-ribose) (PubMed:21892188, PubMed:23102699, PubMed:23474714). PARG acts both as an endo- and exoglycosidase, releasing poly(ADP-ribose) of different length as well as ADP-...
| Schlagworte: | Anti-Poly(ADP-ribose) glycohydrolase |
| Anwendung: | IHC (paraffin), WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
616,00 €
Anti-PARG
Artikelnummer: ARG41050.100
Protein function: Poly(ADP-ribose) glycohydrolase that degrades poly(ADP- ribose) by hydrolyzing the ribose-ribose bonds present in poly(ADP-ribose) (PubMed:21892188, PubMed:23102699, PubMed:23474714). PARG acts both as an endo- and exoglycosidase, releasing poly(ADP-ribose) of different length as well as ADP-...
| Schlagworte: | Anti-Poly(ADP-ribose) glycohydrolase |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
658,00 €
Anti-PARG
Artikelnummer: ATA-HPA021819.100
Protein function: Poly(ADP-ribose) glycohydrolase that degrades poly(ADP- ribose) by hydrolyzing the ribose-ribose bonds present in poly(ADP- ribose) (PubMed:21892188, PubMed:23102699, PubMed:23474714). PARG acts both as an endo- and exoglycosidase, releasing poly(ADP-ribose) of different length as well as...
| Schlagworte: | Anti-Poly(ADP-ribose) glycohydrolase |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 239,00 €
Anti-PARG
Artikelnummer: ATA-HPA053007.100
Protein function: Poly(ADP-ribose) glycohydrolase that degrades poly(ADP- ribose) by hydrolyzing the ribose-ribose bonds present in poly(ADP- ribose) (PubMed:21892188, PubMed:23102699, PubMed:23474714). PARG acts both as an endo- and exoglycosidase, releasing poly(ADP-ribose) of different length as well as...
| Schlagworte: | Anti-Poly(ADP-ribose) glycohydrolase |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 239,00 €
PARG, His-Tag Recombinant
Artikelnummer: BPS-101726
Recombinant human PARG (Poly(ADP-ribose) glycohydrolase), full length encompassing amino acids 2-976 (end). The construct contains an N-terminal His-Tag (6xHis). The recombinant protein was affinity purified.
| Schlagworte: | Poly(ADP-ribose) glycohydrolase, PARG (His-2-976(end)) |
| Anwendung: | Enzyme kinetics, Inhibitor screening, Selectivity profiling |
| Ursprungsart: | human |
819,00 €
PARG Fluorogenic Assay Kit
Artikelnummer: BPS-78858-1
The PARG Fluorogenic Assay Kit is a high-throughput, homogeneous 384-well assay designed to measure the hydrolase activity of Poly (ADP-ribose) glycohydrolase (PARG) for screening and profiling applications, using a simple and straightforward fluorogenic assay. The PARG Fluorogenic Assay Kit contains enough purified...
| Schlagworte: | Poly(ADP-ribose) glycohydrolase, |
| Anwendung: | Enzyme kinetics, small molecule inhibitor screening, drug discovery, HTS |
| Spezies-Reaktivität: | human |
ab 1.270,00 €
Human PARP (Poly ADP Ribose Polymerase) ELISA Kit
Artikelnummer: ELK-ELK4315.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human PARP. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human PARP. Next,...
| Schlagworte: | Poly(ADP-ribose) glycohydrolase |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 374,00 €
PARG (human), recombinant protein
Artikelnummer: ABS-PP-5191.100
| Schlagworte: | Poly(ADP-ribose) glycohydrolase, Recombinant Human PARG Protein |
| MW: | 19 kD |
ab 90,00 €
PARG PrEST Antigen
Artikelnummer: ATA-APrEST95610.100
PrEST Antigen PARG, Gene description: poly(ADP-ribose) glycohydrolase, Antigen sequence: SWMDTEGIKTAESESLDSKENNNTRIESMMSSVQKDNFYQHNVEKLENVSQLSLDKSPTEKSTQYLNQHQTAAMCKWQNEGKHTEQLLESEPQTVT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Poly(ADP-ribose) glycohydrolase that...
| Schlagworte: | Poly(ADP-ribose) glycohydrolase |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €