- Suchergebnis für Q86SJ6
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q86SJ6" wurden 11 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA059456.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium] Buffer: 40% glycerol and...
| Schlagworte: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ABS-PP-539.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Schlagworte: | Desmoglein-4, Cadherin family member 13, Recombinant Human DSG4 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 21 kD |
ab 90,00 €
Artikelnummer: ATA-HPA079244.100
Polyclonal Antibody against Human DSG4, Gene description: desmoglein 4, Alternative Gene Names: CDHF13, LAH, Validated applications: IHC, Uniprot ID: Q86SJ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of intercellular desmosome junctions....
| Schlagworte: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-KC-32557.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Schlagworte: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Artikelnummer: ABS-KC-32659.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Schlagworte: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Artikelnummer: ABS-KC-32679.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Schlagworte: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Artikelnummer: ABS-PP-539-L.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Schlagworte: | Desmoglein-4, Cadherin family member 13, Recombinant Human DSG4 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 21 kD |
ab 115,00 €
Artikelnummer: D3221-85.100
Desmoglein-4 is ~110kD type I transmembrane glycoprotein in the cadherin family of calcium-dependent cell adhesion molecules. Desmogleins interact with transmembrane Desmocollins to form the adhesive components of desmosomes on epithelial cells. Desmoglein-4 contains four cadherin repeats in its extracellular region...
| Anwendung: | WB |
| Wirt: | Sheep |
| Spezies-Reaktivität: | human |
1.025,00 €
Artikelnummer: ATA-APrEST85759.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium] Buffer: PBS and 1M Urea,...
| Schlagworte: | DSG4, CDHF13, Desmoglein-4, Cadherin family member 13 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ELK-ES9587.100
This gene encodes a member of the desmoglein subgroup of desmosomal cadherins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a transmembrane component of desmosomes and may play a role in cell-cell adhesion in epithelial cells. Mutations in the gene are...
| Schlagworte: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13, DSG4 rabbit pAb |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
Artikelnummer: ATA-APrEST95823.100
PrEST Antigen DSG4, Gene description: desmoglein 4, Alternative Gene Names: CDHF13, LAH, Antigen sequence: PAELADYNNVIYAERVLASPGVPDMSNSSTTEGCMGPVMSGNILVGPEIQVMQMMSPDLPIGQTVGSTSPMTSRHRVTRYSNIHYTQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of intercellular...
| Schlagworte: | DSG4, CDHF13, Desmoglein-4, Cadherin family member 13 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €