Zu "Q86SJ6" wurden 11 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-DSG4
Anti-DSG4

Artikelnummer: ATA-HPA059456.100

Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium] Buffer: 40% glycerol and...
Schlagworte: Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
DSG4 (human), recombinant protein
DSG4 (human), recombinant protein

Artikelnummer: ABS-PP-539.100

Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
Schlagworte: Desmoglein-4, Cadherin family member 13, Recombinant Human DSG4 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 21 kD
ab 90,00 €
Bewerten
Anti-DSG4
Anti-DSG4

Artikelnummer: ATA-HPA079244.100

Polyclonal Antibody against Human DSG4, Gene description: desmoglein 4, Alternative Gene Names: CDHF13, LAH, Validated applications: IHC, Uniprot ID: Q86SJ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of intercellular desmosome junctions....
Schlagworte: Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-DSG4
Anti-DSG4

Artikelnummer: ABS-KC-32557.100

Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
Schlagworte: Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13
Anwendung: IHC
Wirt: Mouse
Spezies-Reaktivität: human
ab 206,00 €
Bewerten
Anti-DSG4
Anti-DSG4

Artikelnummer: ABS-KC-32659.100

Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
Schlagworte: Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13
Anwendung: IHC
Wirt: Mouse
Spezies-Reaktivität: human
ab 206,00 €
Bewerten
Anti-DSG4
Anti-DSG4

Artikelnummer: ABS-KC-32679.100

Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
Schlagworte: Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13
Anwendung: IHC
Wirt: Mouse
Spezies-Reaktivität: human
ab 206,00 €
Bewerten
DSG4 (human), recombinant protein
DSG4 (human), recombinant protein

Artikelnummer: ABS-PP-539-L.100

Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
Schlagworte: Desmoglein-4, Cadherin family member 13, Recombinant Human DSG4 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 21 kD
ab 115,00 €
Bewerten
Anti-DSG4 (Desmoglein 4, Cadherin family member 13, CDGF13, CDHF13, Desmoglein-4, LAH)
Anti-DSG4 (Desmoglein 4, Cadherin family member 13,...

Artikelnummer: D3221-85.100

Desmoglein-4 is ~110kD type I transmembrane glycoprotein in the cadherin family of calcium-dependent cell adhesion molecules. Desmogleins interact with transmembrane Desmocollins to form the adhesive components of desmosomes on epithelial cells. Desmoglein-4 contains four cadherin repeats in its extracellular region...
Anwendung: WB
Wirt: Sheep
Spezies-Reaktivität: human
1.025,00 €
Bewerten
DSG4 PrEST Antigen
DSG4 PrEST Antigen

Artikelnummer: ATA-APrEST85759.100

Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium] Buffer: PBS and 1M Urea,...
Schlagworte: DSG4, CDHF13, Desmoglein-4, Cadherin family member 13
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-DSG4
Anti-DSG4

Artikelnummer: ELK-ES9587.100

This gene encodes a member of the desmoglein subgroup of desmosomal cadherins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a transmembrane component of desmosomes and may play a role in cell-cell adhesion in epithelial cells. Mutations in the gene are...
Schlagworte: Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13, DSG4 rabbit pAb
Anwendung: WB, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 173,00 €
Bewerten
DSG4 PrEST Antigen
DSG4 PrEST Antigen

Artikelnummer: ATA-APrEST95823.100

PrEST Antigen DSG4, Gene description: desmoglein 4, Alternative Gene Names: CDHF13, LAH, Antigen sequence: PAELADYNNVIYAERVLASPGVPDMSNSSTTEGCMGPVMSGNILVGPEIQVMQMMSPDLPIGQTVGSTSPMTSRHRVTRYSNIHYTQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of intercellular...
Schlagworte: DSG4, CDHF13, Desmoglein-4, Cadherin family member 13
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten