Zu "Q86SG5" wurden 10 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Protein S100-A7A (S100A7A), partial, human, recombinant
Artikelnummer: CSB-YP771423HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 2-101aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: SNTQAERSII GMIDMFHKYT GRDGKIEKPS LLTMMKENFP NFLSACDKKG IHYLATVFEK KDKNEDKKID FSEFLSLLGD IAADYHKQSH GAAPCSGGSQ. Purity: Greater than 90% as determined by...
| Schlagworte: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | human |
| MW: | 13.2 kD |
ab 257,00 €
Protein S100-A7A (S100A7A), partial, human, recombinant
Artikelnummer: CSB-EP771423HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 2-101aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: SNTQAERSII GMIDMFHKYT GRDGKIEKPS LLTMMKENFP NFLSACDKKG IHYLATVFEK KDKNEDKKID FSEFLSLLGD IAADYHKQSH GAAPCSGGSQ. Purity: Greater than 90% as determined...
| Schlagworte: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 27.2 kD |
ab 213,00 €
Human S100A15 (S100 Calcium Binding Protein A15) ELISA Kit
Artikelnummer: ELK-ELK7320.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human S100A15. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human S100A15....
| Schlagworte: | S100A7A, S100A15, Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, S100... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 365,00 €
NEU
Human Protein S100-A7A (S100A7A) ELISA kit
Artikelnummer: CSB-EL020636HU.48
Sample Types: serum, plasma, tissue homogenates, urine Detection Range: 0.312 ng/mL-20 ng/mL Sensitivity: 0.078 ng/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: May be involved in epidermal differentiation and inflammation...
| Schlagworte: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, S100... |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | human |
ab 603,00 €
NEU
S100A7A Protein, Human, Recombinant (His)
Artikelnummer: TGM-TMPH-01951-100ug
Description: May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. S100A7A Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.2 kDa and the accession number is...
| Schlagworte: | S100 calcium-binding protein A7-like 1, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, Protein... |
| MW: | 13.2 kD |
ab 226,00 €
Anti-S100A7A
Artikelnummer: ELK-ES13279.100
function:May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.,similarity:Belongs to the S-100 family.,similarity:Contains 2 EF-hand domains.,tissue specificity:Overexpressed in psoriasis., Protein function: May be...
| Schlagworte: | Anti-S100A7A, Anti-S100A15, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A15, Anti-S100 calcium-binding... |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 169,00 €
Anti-S1A7A
Artikelnummer: ELK-ES10066.100
function:May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.,similarity:Belongs to the S-100 family.,similarity:Contains 2 EF-hand domains.,tissue specificity:Overexpressed in psoriasis., Protein function: May be...
| Schlagworte: | Anti-S100A7A, Anti-S100A15, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A15, Anti-S100 calcium-binding... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 169,00 €
Anti-S100A15 (S100 Calcium Binding Protein A15, S100A7A,...
Artikelnummer: 364956.200
The human calcium-binding protein (hS100A15) was first identified in inflamed hyperplastic psoriatic skin, where the S100A15 gene is transcribed into two mRNA splice variants, hS100A15-S and hS100A15-L. In cultured keratinocytes, IL-1beta and Th1 cytokines significantly induced hS100A15-L compared with hS100A15-S....
| Schlagworte: | Anti-S100A15, Anti-S100A7A, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A7A, Anti-S100 calcium-binding... |
| Anwendung: | ELISA, ICC, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
612,00 €
S100A7A, Recombinant, Human, aa2-101, His-SUMO-Tag...
Artikelnummer: 375182.100
Source:, Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.2kD, AA Sequence: SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ, Storage and Stability: May be stored at...
| Schlagworte: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
| MW: | 27,2 |
ab 511,00 €
S100A7A, Recombinant, Human, aa2-101, His-Tag (Protein...
Artikelnummer: 375183.100
May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. Source: Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.2kD, AA Sequence:...
| Schlagworte: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
| MW: | 13,2 |
ab 531,00 €