- Suchergebnis für Q86SG5
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q86SG5" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: TGM-TMPH-01951-100ug
Description: May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. S100A7A Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.2 kDa and the accession number is...
Schlagworte: | S100 calcium-binding protein A7-like 1, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, Protein... |
MW: | 13.2 kD |
ab 229,00 €
Artikelnummer: CSB-YP771423HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 2-101aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: SNTQAERSII GMIDMFHKYT GRDGKIEKPS LLTMMKENFP NFLSACDKKG IHYLATVFEK KDKNEDKKID FSEFLSLLGD IAADYHKQSH GAAPCSGGSQ. Purity: Greater than 90% as determined by...
Schlagworte: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
Anwendung: | Activity not tested |
Exprimiert in: | Yeast |
Ursprungsart: | human |
MW: | 13.2 kD |
ab 265,00 €
Artikelnummer: CSB-EP771423HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 2-101aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: SNTQAERSII GMIDMFHKYT GRDGKIEKPS LLTMMKENFP NFLSACDKKG IHYLATVFEK KDKNEDKKID FSEFLSLLGD IAADYHKQSH GAAPCSGGSQ. Purity: Greater than 90% as determined...
Schlagworte: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
Anwendung: | Activity not tested |
Exprimiert in: | E.coli |
Ursprungsart: | human |
MW: | 27.2 kD |
ab 219,00 €
Artikelnummer: ELK-ELK7320.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human S100A15. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human S100A15....
Schlagworte: | S100A7A, S100A15, Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, S100... |
Anwendung: | ELISA |
Spezies-Reaktivität: | human |
ab 374,00 €

Artikelnummer: CSB-PA771423ZA01HU.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: | Anti-S100A7A, Anti-S100A15, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A15, Anti-S100 calcium-binding... |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | Homo sapiens (Human) |
ab 1.529,00 €

Artikelnummer: ABS-PP-5182.100
Schlagworte: | Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7-like 1, S100 calcium-binding protein... |
MW: | 12.5 kD |
ab 90,00 €

Artikelnummer: CSB-EL020636HU.48
Sample Types: serum, plasma, tissue homogenates, urine Detection Range: 0.312 ng/mL-20 ng/mL Sensitivity: 0.078 ng/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: May be involved in epidermal differentiation and inflammation...
Schlagworte: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, S100... |
Anwendung: | ELISA, Sandwich ELISA |
Spezies-Reaktivität: | human |
ab 622,00 €

Artikelnummer: 364956.200
The human calcium-binding protein (hS100A15) was first identified in inflamed hyperplastic psoriatic skin, where the S100A15 gene is transcribed into two mRNA splice variants, hS100A15-S and hS100A15-L. In cultured keratinocytes, IL-1beta and Th1 cytokines significantly induced hS100A15-L compared with hS100A15-S....
Schlagworte: | Anti-S100A15, Anti-S100A7A, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A7A, Anti-S100 calcium-binding... |
Anwendung: | ELISA, ICC, IHC, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
659,00 €

Artikelnummer: 375182.100
Source:, Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.2kD, AA Sequence: SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ, Storage and Stability: May be stored at...
Schlagworte: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
MW: | 27,2 |
ab 523,00 €

Artikelnummer: 375183.100
May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. Source: Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.2kD, AA Sequence:...
Schlagworte: | S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100... |
MW: | 13,2 |
ab 543,00 €

Artikelnummer: ELK-ES13279.100
function:May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.,similarity:Belongs to the S-100 family.,similarity:Contains 2 EF-hand domains.,tissue specificity:Overexpressed in psoriasis., Protein function: May be...
Schlagworte: | Anti-S100A7A, Anti-S100A15, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A15, Anti-S100 calcium-binding... |
Anwendung: | IHC, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €

Artikelnummer: ELK-ES10066.100
function:May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.,similarity:Belongs to the S-100 family.,similarity:Contains 2 EF-hand domains.,tissue specificity:Overexpressed in psoriasis., Protein function: May be...
Schlagworte: | Anti-S100A7A, Anti-S100A15, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A15, Anti-S100 calcium-binding... |
Anwendung: | WB, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €