Zu "Q86SG5" wurden 12 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
S100A7A Protein, Human, Recombinant (His)
S100A7A Protein, Human, Recombinant (His)

Artikelnummer: TGM-TMPH-01951-100ug

Description: May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. S100A7A Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.2 kDa and the accession number is...
Schlagworte: S100 calcium-binding protein A7-like 1, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, Protein...
MW: 13.2 kD
ab 229,00 €
Bewerten
Protein S100-A7A (S100A7A), partial, human, recombinant
Protein S100-A7A (S100A7A), partial, human, recombinant

Artikelnummer: CSB-YP771423HU.1

Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 2-101aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: SNTQAERSII GMIDMFHKYT GRDGKIEKPS LLTMMKENFP NFLSACDKKG IHYLATVFEK KDKNEDKKID FSEFLSLLGD IAADYHKQSH GAAPCSGGSQ. Purity: Greater than 90% as determined by...
Schlagworte: S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100...
Anwendung: Activity not tested
Exprimiert in: Yeast
Ursprungsart: human
MW: 13.2 kD
ab 265,00 €
Bewerten
Protein S100-A7A (S100A7A), partial, human, recombinant
Protein S100-A7A (S100A7A), partial, human, recombinant

Artikelnummer: CSB-EP771423HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 2-101aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: SNTQAERSII GMIDMFHKYT GRDGKIEKPS LLTMMKENFP NFLSACDKKG IHYLATVFEK KDKNEDKKID FSEFLSLLGD IAADYHKQSH GAAPCSGGSQ. Purity: Greater than 90% as determined...
Schlagworte: S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 27.2 kD
ab 219,00 €
Bewerten
Human S100A15 (S100 Calcium Binding Protein A15) ELISA Kit
Human S100A15 (S100 Calcium Binding Protein A15) ELISA Kit

Artikelnummer: ELK-ELK7320.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human S100A15. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human S100A15....
Schlagworte: S100A7A, S100A15, Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, S100...
Anwendung: ELISA
Spezies-Reaktivität: human
ab 374,00 €
Bewerten
Anti-S100A7A
Anti-S100A7A

Artikelnummer: CSB-PA771423ZA01HU.2

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-S100A7A, Anti-S100A15, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A15, Anti-S100 calcium-binding...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Homo sapiens (Human)
ab 1.529,00 €
Bewerten
S100A7A (human), recombinant protein
S100A7A (human), recombinant protein

Artikelnummer: ABS-PP-5182.100

Schlagworte: Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7-like 1, S100 calcium-binding protein...
MW: 12.5 kD
ab 90,00 €
Bewerten
Human Protein S100-A7A (S100A7A) ELISA kit
Human Protein S100-A7A (S100A7A) ELISA kit

Artikelnummer: CSB-EL020636HU.48

Sample Types: serum, plasma, tissue homogenates, urine Detection Range: 0.312 ng/mL-20 ng/mL Sensitivity: 0.078 ng/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: May be involved in epidermal differentiation and inflammation...
Schlagworte: S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7A, S100...
Anwendung: ELISA, Sandwich ELISA
Spezies-Reaktivität: human
ab 622,00 €
Bewerten
Anti-S100A15 (S100 Calcium Binding Protein A15, S100A7A, S100A7L1, S100A7f, S100 calcium-binding pro
Anti-S100A15 (S100 Calcium Binding Protein A15, S100A7A,...

Artikelnummer: 364956.200

The human calcium-binding protein (hS100A15) was first identified in inflamed hyperplastic psoriatic skin, where the S100A15 gene is transcribed into two mRNA splice variants, hS100A15-S and hS100A15-L. In cultured keratinocytes, IL-1beta and Th1 cytokines significantly induced hS100A15-L compared with hS100A15-S....
Schlagworte: Anti-S100A15, Anti-S100A7A, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A7A, Anti-S100 calcium-binding...
Anwendung: ELISA, ICC, IHC, WB
Wirt: Rabbit
Spezies-Reaktivität: human
659,00 €
Bewerten
S100A7A, Recombinant, Human, aa2-101, His-SUMO-Tag (Protein S100-A7A)
S100A7A, Recombinant, Human, aa2-101, His-SUMO-Tag...

Artikelnummer: 375182.100

Source:, Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.2kD, AA Sequence: SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ, Storage and Stability: May be stored at...
Schlagworte: S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100...
MW: 27,2
ab 523,00 €
Bewerten
S100A7A, Recombinant, Human, aa2-101, His-Tag (Protein S100-A7A)
S100A7A, Recombinant, Human, aa2-101, His-Tag (Protein...

Artikelnummer: 375183.100

May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. Source: Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.2kD, AA Sequence:...
Schlagworte: S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100...
MW: 13,2
ab 543,00 €
Bewerten
Anti-S100A7A
Anti-S100A7A

Artikelnummer: ELK-ES13279.100

function:May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.,similarity:Belongs to the S-100 family.,similarity:Contains 2 EF-hand domains.,tissue specificity:Overexpressed in psoriasis., Protein function: May be...
Schlagworte: Anti-S100A7A, Anti-S100A15, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A15, Anti-S100 calcium-binding...
Anwendung: IHC, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, rat, mouse,
ab 173,00 €
Bewerten
Anti-S1A7A
Anti-S1A7A

Artikelnummer: ELK-ES10066.100

function:May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.,similarity:Belongs to the S-100 family.,similarity:Contains 2 EF-hand domains.,tissue specificity:Overexpressed in psoriasis., Protein function: May be...
Schlagworte: Anti-S100A7A, Anti-S100A15, Anti-Protein S100-A7A, Anti-S100 calcium-binding protein A15, Anti-S100 calcium-binding...
Anwendung: WB, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, rat, mouse,
ab 173,00 €
Bewerten