- Suchergebnis für Q7Z407
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q7Z407" wurden 14 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA029007.100
Protein function: Involved in dendrite development. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to rat: 49%
| Schlagworte: | Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: ATA-HPA029008.100
Polyclonal Antibody against Human CSMD3, Gene description: CUB and Sushi multiple domains 3, Validated applications: ICC, Uniprot ID: Q7Z407, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in dendrite development. [The UniProt Consortium] Mouse...
| Schlagworte: | Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA029008.25
Polyclonal Antibody against Human CSMD3, Gene description: CUB and Sushi multiple domains 3, Validated applications: ICC, Uniprot ID: Q7Z407, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in dendrite development. [The UniProt Consortium] Mouse...
| Schlagworte: | Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: C2566-02.100
Applications: , Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Peptide ELISA: 1:16,000. , Western Blot: Preliminary experiments in human brain (substantia nigra and hippocampus) lysates gave no specific signal but low background (at antibody concentration up to 1ug/ml)., Optimal...
| Schlagworte: | Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3 |
| Anwendung: | ELISA |
| Wirt: | Goat |
| Spezies-Reaktivität: | dog, human, mouse, rat |
557,00 €
Artikelnummer: ATA-APrEST77744.100
Protein function: Involved in dendrite development. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | CSMD3, KIAA1894, CUB and sushi multiple domains protein 3, CUB and sushi domain-containing protein 3 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: G-CAB12199.20
Protein function: Involved in dendrite development. [The UniProt Consortium]
| Schlagworte: | Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3 |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
103,00 €
Artikelnummer: ELK-ES19215.100
Protein function: Involved in dendrite development. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular localization: Cell membrane , Multi-pass membrane protein .
| Schlagworte: | Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
Artikelnummer: CSB-PA800102LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CSMD3. Antigen Species: Human
| Schlagworte: | Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3,... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA800102LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CSMD3. Antigen Species: Human
| Schlagworte: | Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA800102LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CSMD3. Antigen Species: Human
| Schlagworte: | Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3,... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA800102LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CSMD3. Antigen Species: Human
| Schlagworte: | Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: ATA-APrEST95764.100
PrEST Antigen CSMD3, Gene description: CUB and Sushi multiple domains 3, Antigen sequence: SAPYQGSSTLTHTTSTGELEEHNRTTTGAIAVASTPADVTVSSVTAVTIHRLSEEQRVQVTSLRNSGLDPNTSKDGLSPHPADTQSTRRRP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in dendrite development. [The...
| Schlagworte: | CSMD3, KIAA1894, CUB and sushi multiple domains protein 3, CUB and sushi domain-containing protein 3 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €