Zu "Q7Z407" wurden 14 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-CSMD3
Anti-CSMD3

Artikelnummer: ATA-HPA029007.100

Protein function: Involved in dendrite development. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to rat: 49%
Schlagworte: Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
Anti-CSMD3
Anti-CSMD3

Artikelnummer: ATA-HPA029008.100

Polyclonal Antibody against Human CSMD3, Gene description: CUB and Sushi multiple domains 3, Validated applications: ICC, Uniprot ID: Q7Z407, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in dendrite development. [The UniProt Consortium] Mouse...
Schlagworte: Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-CSMD3
Anti-CSMD3

Artikelnummer: ATA-HPA029008.25

Polyclonal Antibody against Human CSMD3, Gene description: CUB and Sushi multiple domains 3, Validated applications: ICC, Uniprot ID: Q7Z407, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in dendrite development. [The UniProt Consortium] Mouse...
Schlagworte: Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
Anti-CSMD3 (CUB and Sushi multiple domains 3, KIAA1894)
Anti-CSMD3 (CUB and Sushi multiple domains 3, KIAA1894)

Artikelnummer: C2566-02.100

Applications: , Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Peptide ELISA: 1:16,000. , Western Blot: Preliminary experiments in human brain (substantia nigra and hippocampus) lysates gave no specific signal but low background (at antibody concentration up to 1ug/ml)., Optimal...
Schlagworte: Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3
Anwendung: ELISA
Wirt: Goat
Spezies-Reaktivität: dog, human, mouse, rat
557,00 €
Bewerten
CSMD3 PrEST Antigen
CSMD3 PrEST Antigen

Artikelnummer: ATA-APrEST77744.100

Protein function: Involved in dendrite development. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: CSMD3, KIAA1894, CUB and sushi multiple domains protein 3, CUB and sushi domain-containing protein 3
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-CSMD3
Anti-CSMD3

Artikelnummer: G-CAB12199.20

Protein function: Involved in dendrite development. [The UniProt Consortium]
Schlagworte: Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human
103,00 €
Bewerten
Anti-CSMD3
Anti-CSMD3

Artikelnummer: ELK-ES19215.100

Protein function: Involved in dendrite development. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular localization: Cell membrane , Multi-pass membrane protein .
Schlagworte: Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3,...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 173,00 €
Bewerten
Anti-CSMD3
Anti-CSMD3

Artikelnummer: CSB-PA800102LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CSMD3. Antigen Species: Human
Schlagworte: Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3,...
Anwendung: ELISA, IHC, IF
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-CSMD3, HRP conjugated
Anti-CSMD3, HRP conjugated

Artikelnummer: CSB-PA800102LB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CSMD3. Antigen Species: Human
Schlagworte: Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3,...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-CSMD3, FITC conjugated
Anti-CSMD3, FITC conjugated

Artikelnummer: CSB-PA800102LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CSMD3. Antigen Species: Human
Schlagworte: Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3,...
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-CSMD3, Biotin conjugated
Anti-CSMD3, Biotin conjugated

Artikelnummer: CSB-PA800102LD01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CSMD3. Antigen Species: Human
Schlagworte: Anti-CSMD3, Anti-KIAA1894, Anti-CUB and sushi multiple domains protein 3, Anti-CUB and sushi domain-containing protein 3,...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
CSMD3 PrEST Antigen
CSMD3 PrEST Antigen

Artikelnummer: ATA-APrEST95764.100

PrEST Antigen CSMD3, Gene description: CUB and Sushi multiple domains 3, Antigen sequence: SAPYQGSSTLTHTTSTGELEEHNRTTTGAIAVASTPADVTVSSVTAVTIHRLSEEQRVQVTSLRNSGLDPNTSKDGLSPHPADTQSTRRRP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in dendrite development. [The...
Schlagworte: CSMD3, KIAA1894, CUB and sushi multiple domains protein 3, CUB and sushi domain-containing protein 3
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
1 von 2 Seiten