- Suchergebnis für Q6UXT8
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q6UXT8" wurden 13 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA027368.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 65% and to rat: 70%
| Schlagworte: | Anti-FAM150A, Anti-AUG-beta, Anti-Augmentor beta, Anti-Protein FAM150A, Anti-ALK and LTK ligand 1 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: CSB-BP757795HU.1
Organism: Homo sapiens (Human). Source: Baculovirus. Expression Region: 28-129aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: RPRGRRGARV TDKEPKPLLF LPAAGAGRTP SGSRSAEIFP RDSNLKDKFI KHFTGPVTFS PECSKHFHRL YYNTRECSTP AYYKRCARLL...
| Schlagworte: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1, Recombinant Human ALK and LTK ligand 1 (ALKAL1) |
| Anwendung: | Activity not tested |
| Exprimiert in: | Insect cells |
| Ursprungsart: | human |
| MW: | 15.4 kD |
ab 489,00 €
Artikelnummer: CSB-EP757795HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 28-129aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: RPRGRRGARV TDKEPKPLLF LPAAGAGRTP SGSRSAEIFP RDSNLKDKFI KHFTGPVTFS PECSKHFHRL YYNTRECSTP AYYKRCARLL TRLAVSPLCS QT. Purity: Greater...
| Schlagworte: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1, Recombinant Human ALK and LTK ligand 1 (ALKAL1) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 25.5 kD |
ab 292,00 €
Artikelnummer: TGM-TMPY-04317-100ug
Description: FAM150A Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with mFc tag. The predicted molecular weight is 37.93 kDa and the accession number is Q6UXT8.
| Schlagworte: | FAM150A, UNQ9433, family with sequence similarity 150 member A |
| MW: | 37.93 kD |
768,00 €
Artikelnummer: TGM-TMPY-04317-10ug
Description: FAM150A Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with mFc tag. The predicted molecular weight is 37.93 kDa and the accession number is Q6UXT8.
| Schlagworte: | FAM150A , UNQ9433 , family with sequence similarity 150 member A |
| MW: | 37.93 kD |
ab 75,00 €
Artikelnummer: 374877.100
Source:, Recombinant protein corresponding to aa28-129 from human FAM150A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.5kD, AA Sequence: RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT, Storage and Stability: May be stored...
| Schlagworte: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1 |
| MW: | 27,5 |
ab 690,00 €
Artikelnummer: ATA-APrEST76439.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: E-PKSH030534.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
| Ursprungsart: | human |
924,00 €
Artikelnummer: G-RPES3663.100
Human FAM150A Recombinant Protein (RPES3663) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
| Schlagworte: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1 |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
1.471,00 €
Artikelnummer: CSB-CL757795HU.10
Length: 390 Sequence: atgcggcccc ttaagcccgg cgcccctttg cccgcactct tcctgctggc gctggctttg tccccgcacg gagcccacgg gaggccccgg gggcgcaggg gagcgcgcgt cacggataag gagcccaagc cgttgctttt cctccccgcg gccggggccg gccggactcc cagcggctcc cggagcgcag aaatattccc aagagactct aacttaaaag acaaattcat aaagcatttc acagggccgg tcacattttc...
| Schlagworte: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Artikelnummer: ABS-PQ-869.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
| Schlagworte: | ALK and LTK ligand 1, Augmentor beta, AUG-beta, Recombinant Human ALKAL1 Protein |
| Exprimiert in: | human cells |
| Ursprungsart: | human |
| MW: | 12.5 kD |
ab 270,00 €
Artikelnummer: CSB-PA757795ZA01HU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-FAM150A, Anti-AUG-beta, Anti-Augmentor beta, Anti-Protein FAM150A, Anti-ALK and LTK ligand 1, ALKAL1 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Homo sapiens (Human) |
ab 1.529,00 €