Zu "Q6UXT8" wurden 13 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ALKAL1
Artikelnummer: ATA-HPA027368.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 65% and to rat: 70%
| Schlagworte: | Anti-FAM150A, Anti-AUG-beta, Anti-Augmentor beta, Anti-Protein FAM150A, Anti-ALK and LTK ligand 1 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
ALK and LTK ligand 1 (ALKAL1), human, recombinant
Artikelnummer: CSB-BP757795HU.1
Organism: Homo sapiens (Human). Source: Baculovirus. Expression Region: 28-129aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: RPRGRRGARV TDKEPKPLLF LPAAGAGRTP SGSRSAEIFP RDSNLKDKFI KHFTGPVTFS PECSKHFHRL YYNTRECSTP AYYKRCARLL...
| Schlagworte: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1, Recombinant Human ALK and LTK ligand 1 (ALKAL1) |
| Anwendung: | Activity not tested |
| Exprimiert in: | Insect cells |
| Ursprungsart: | human |
| MW: | 15.4 kD |
ab 489,00 €
ALK and LTK ligand 1 (ALKAL1), human, recombinant
Artikelnummer: CSB-EP757795HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 28-129aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: RPRGRRGARV TDKEPKPLLF LPAAGAGRTP SGSRSAEIFP RDSNLKDKFI KHFTGPVTFS PECSKHFHRL YYNTRECSTP AYYKRCARLL TRLAVSPLCS QT. Purity: Greater...
| Schlagworte: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1, Recombinant Human ALK and LTK ligand 1 (ALKAL1) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 25.5 kD |
ab 292,00 €
FAM150A Protein, Human, Recombinant (mFc)
Artikelnummer: TGM-TMPY-04317-100ug
Description: FAM150A Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with mFc tag. The predicted molecular weight is 37.93 kDa and the accession number is Q6UXT8.
| Schlagworte: | FAM150A, UNQ9433, family with sequence similarity 150 member A |
| MW: | 37.93 kD |
768,00 €
FAM150A Protein, Human, Recombinant (mFc)
Artikelnummer: TGM-TMPY-04317-10ug
Description: FAM150A Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with mFc tag. The predicted molecular weight is 37.93 kDa and the accession number is Q6UXT8.
| Schlagworte: | FAM150A , UNQ9433 , family with sequence similarity 150 member A |
| MW: | 37.93 kD |
ab 75,00 €
Protein FAM150A, Recombinant, Human, aa28-129,...
Artikelnummer: 374877.100
Source:, Recombinant protein corresponding to aa28-129 from human FAM150A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.5kD, AA Sequence: RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT, Storage and Stability: May be stored...
| Schlagworte: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1 |
| MW: | 27,5 |
ab 690,00 €
ALKAL1 (human), recombinant protein
Artikelnummer: ABS-PQ-869-L.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
| Schlagworte: | ALK and LTK ligand 1, Augmentor beta, AUG-beta, Recombinant Human ALKAL1 Protein |
| Exprimiert in: | human cells |
| Ursprungsart: | human |
| MW: | 12.5 kD |
ab 295,00 €
ALKAL1 PrEST Antigen
Artikelnummer: ATA-APrEST76439.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Human FAM150A Protein (Fc Tag)
Artikelnummer: E-PKSH030534.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
| Ursprungsart: | human |
924,00 €
Recombinant Human FAM150A Protein (Fc Tag) (RPES3663)
Artikelnummer: G-RPES3663.100
Human FAM150A Recombinant Protein (RPES3663) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
| Schlagworte: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1 |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
1.471,00 €
FAM150A (Vector Vector will be determined during the...
Artikelnummer: CSB-CL757795HU.10
Length: 390 Sequence: atgcggcccc ttaagcccgg cgcccctttg cccgcactct tcctgctggc gctggctttg tccccgcacg gagcccacgg gaggccccgg gggcgcaggg gagcgcgcgt cacggataag gagcccaagc cgttgctttt cctccccgcg gccggggccg gccggactcc cagcggctcc cggagcgcag aaatattccc aagagactct aacttaaaag acaaattcat aaagcatttc acagggccgg tcacattttc...
| Schlagworte: | FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
ALKAL1 (human), recombinant protein
Artikelnummer: ABS-PQ-869.100
Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
| Schlagworte: | ALK and LTK ligand 1, Augmentor beta, AUG-beta, Recombinant Human ALKAL1 Protein |
| Exprimiert in: | human cells |
| Ursprungsart: | human |
| MW: | 12.5 kD |
ab 270,00 €