Zu "Q6DN14" wurden 5 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MCTP1
Anti-MCTP1

Artikelnummer: ATA-HPA075887.100

Polyclonal Antibody against Human MCTP1, Gene description: multiple C2 and transmembrane domain containing 1, Alternative Gene Names: FLJ22344, Validated applications: ICC, WB, Uniprot ID: Q6DN14, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Calcium...
Schlagworte: Anti-MCTP1, Anti-Multiple C2 and transmembrane domain-containing protein 1
Anwendung: WB, ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
MCTP1 (human), recombinant protein
MCTP1 (human), recombinant protein

Artikelnummer: ABS-PP-2302-L.100

Protein function: Calcium sensor which is essential for the stabilization of normal baseline neurotransmitter release and for the induction and long-term maintenance of presynaptic homeostatic plasticity. [The UniProt Consortium]
Schlagworte: Multiple C2 and transmembrane domain-containing protein 1, Recombinant Human MCTP1 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 15.5 kD
ab 115,00 €
Bewerten
MCTP1, Human multiple C2 domains, transmembrane 1, Real Time PCR Primer Set
MCTP1, Human multiple C2 domains, transmembrane 1, Real...

Artikelnummer: VHPS-5622

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: MCTP1, Multiple C2 and transmembrane domain-containing protein 1
Anwendung: RNA quantification
45,00 €
Bewerten
MCTP1 (human), recombinant protein
MCTP1 (human), recombinant protein

Artikelnummer: ABS-PP-2302.100

Protein function: Calcium sensor which is essential for the stabilization of normal baseline neurotransmitter release and for the induction and long-term maintenance of presynaptic homeostatic plasticity. [The UniProt Consortium]
Schlagworte: Multiple C2 and transmembrane domain-containing protein 1, Recombinant Human MCTP1 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 15.5 kD
ab 90,00 €
Bewerten
MCTP1 PrEST Antigen
MCTP1 PrEST Antigen

Artikelnummer: ATA-APrEST96232.100

PrEST Antigen MCTP1, Gene description: multiple C2 and transmembrane domain containing 1, Alternative Gene Names: FLJ22344, Antigen sequence: MLDSCKLKSACNLPFICNKKIINTAGTSNAEVPLADPGMYQLDITLRRGQSLAARDRGGTSD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Calcium sensor...
Schlagworte: MCTP1, Multiple C2 and transmembrane domain-containing protein 1
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten