Zu "Q6AYE8" wurden 7 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Artemin (Artn), rat, recombinant
Artemin (Artn), rat, recombinant

Artikelnummer: CSB-EP002160RA.1

Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 112-224aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: AGTRSSRARA TDARGCRLRS QLVPVSALGL GHSSDELIRF RFCSGSCRRA RSPHDLSLAS LLDAGALRSP PGSRPISQPC CRPTRYEAVS...
Schlagworte: Artn, Artemin, Recombinant Rat Artemin (Artn)
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: rat
MW: 17.1kDa kD
ab 364,00 €
Bewerten
Artemin Protein, Rat, Recombinant (His & Myc)
Artemin Protein, Rat, Recombinant (His & Myc)

Artikelnummer: TGM-TMPH-03247-100ug

Description: Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut...
Schlagworte: Artemin, Artn
MW: 17.1 kD
ab 340,00 €
Bewerten
NEU
Artemin Protein, Rat, Recombinant (His & Myc)
Artemin Protein, Rat, Recombinant (His & Myc)

Artikelnummer: TGM-TMPH-03247-10ug

Description: Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut...
Schlagworte: Artn , Artemin
MW: 17.1 kD
ab 122,00 €
Bewerten
Artn, Rat artemin, Real Time PCR Primer Set
Artn, Rat artemin, Real Time PCR Primer Set

Artikelnummer: VRPS-455

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: Artn, Artemin
Anwendung: RNA quantification
54,00 €
Bewerten
Artemin (ARTN) Recombinant, Rat
Artemin (ARTN) Recombinant, Rat

Artikelnummer: 153610.10

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q6AYE8, Fragment: Ala112~Gly224 (Accession No: Q6AYE8), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-AGTRSSRAR ATDARGCRLR SQLVPVSALG LGHSSDELIR FRFCSGSCRR ARSPHDLSLA SLLDAGALRS PPGSRPISQP...
ab 454,00 €
Bewerten
Artemin, Recombinant, Rat, aa112-224, His-Tag, Myc-Tag (Artn)
Artemin, Recombinant, Rat, aa112-224, His-Tag, Myc-Tag...

Artikelnummer: 517806.20

Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus...
Schlagworte: Artn, Artemin
Exprimiert in: E.coli
Ursprungsart: rat
MW: 17.1 kD
ab 786,00 €
Bewerten
Anti-Artn
Anti-Artn

Artikelnummer: CSB-PA002160ZA01RA.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-Artn, Anti-Artemin, Artn Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Rattus norvegicus (Rat)
ab 1.529,00 €
Bewerten