- Suchergebnis für Q6AYE8
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q6AYE8" wurden 7 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: CSB-EP002160RA.1
Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 112-224aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: AGTRSSRARA TDARGCRLRS QLVPVSALGL GHSSDELIRF RFCSGSCRRA RSPHDLSLAS LLDAGALRSP PGSRPISQPC CRPTRYEAVS...
| Schlagworte: | Artn, Artemin, Recombinant Rat Artemin (Artn) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
| MW: | 17.1kDa kD |
ab 364,00 €
Artikelnummer: TGM-TMPH-03247-100ug
Description: Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut...
| Schlagworte: | Artemin, Artn |
| MW: | 17.1 kD |
ab 340,00 €
NEU
Artikelnummer: TGM-TMPH-03247-10ug
Description: Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut...
| Schlagworte: | Artn , Artemin |
| MW: | 17.1 kD |
ab 122,00 €
Artikelnummer: VRPS-455
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Artn, Artemin |
| Anwendung: | RNA quantification |
54,00 €
Artikelnummer: 153610.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q6AYE8, Fragment: Ala112~Gly224 (Accession No: Q6AYE8), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-AGTRSSRAR ATDARGCRLR SQLVPVSALG LGHSSDELIR FRFCSGSCRR ARSPHDLSLA SLLDAGALRS PPGSRPISQP...
ab 454,00 €
Artikelnummer: 517806.20
Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus...
| Schlagworte: | Artn, Artemin |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
| MW: | 17.1 kD |
ab 786,00 €
Artikelnummer: CSB-PA002160ZA01RA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-Artn, Anti-Artemin, Artn Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Rattus norvegicus (Rat) |
ab 1.529,00 €