- Suchergebnis für Q5VXU9
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q5VXU9" wurden 5 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA052214.100
Polyclonal Antibody against Human SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84, FLJ32779, MZIP2, Zip2, Validated applications: ICC, Uniprot ID: Q5VXU9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: ATPase required...
| Schlagworte: | Anti-MZIP2, Anti-Protein ZIP2 homolog, Anti-Protein shortage in chiasmata 1 ortholog |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA052214.25
Polyclonal Antibody against Human SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84, FLJ32779, MZIP2, Zip2, Validated applications: ICC, Uniprot ID: Q5VXU9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: ATPase required...
| Schlagworte: | Anti-MZIP2, Anti-Protein ZIP2 homolog, Anti-Protein shortage in chiasmata 1 ortholog |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: ABS-PP-7130.100
Protein function: ATPase required during meiosis for the formation of crossover recombination intermediates. Binds DNA: preferentially binds to single-stranded DNA and DNA branched structures (PubMed:29742103). Does not show nuclease activity in vitro, but shows ATPase activity, which is stimulated by the presence...
| Schlagworte: | Protein shortage in chiasmata 1 ortholog, Protein ZIP2 homolog, MZIP2, Recombinant Human SHOC1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95882.100
PrEST Antigen SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84, FLJ32779, MZIP2, Zip2, Antigen sequence: LTNKHGIEDIGDIKFSSTEILTIQSQSEPEECSKPGELEMPLTPLFLTCQHSSVNSLRTELQTFPLSPVCKI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: ATPase...
| Schlagworte: | MZIP2, Protein ZIP2 homolog, Protein shortage in chiasmata 1 ortholog |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-PP-7130-L.100
Protein function: ATPase required during meiosis for the formation of crossover recombination intermediates. Binds DNA: preferentially binds to single-stranded DNA and DNA branched structures (PubMed:29742103). Does not show nuclease activity in vitro, but shows ATPase activity, which is stimulated by the presence...
| Schlagworte: | Protein shortage in chiasmata 1 ortholog, Protein ZIP2 homolog, MZIP2, Recombinant Human SHOC1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.5 kD |
ab 115,00 €
