Zu "Q5VXU9" wurden 5 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-SHOC1
Anti-SHOC1

Artikelnummer: ATA-HPA052214.100

Polyclonal Antibody against Human SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84, FLJ32779, MZIP2, Zip2, Validated applications: ICC, Uniprot ID: Q5VXU9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: ATPase required...
Schlagworte: Anti-MZIP2, Anti-Protein ZIP2 homolog, Anti-Protein shortage in chiasmata 1 ortholog
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-SHOC1
Anti-SHOC1

Artikelnummer: ATA-HPA052214.25

Polyclonal Antibody against Human SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84, FLJ32779, MZIP2, Zip2, Validated applications: ICC, Uniprot ID: Q5VXU9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: ATPase required...
Schlagworte: Anti-MZIP2, Anti-Protein ZIP2 homolog, Anti-Protein shortage in chiasmata 1 ortholog
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
SHOC1 (human), recombinant protein
SHOC1 (human), recombinant protein

Artikelnummer: ABS-PP-7130.100

Protein function: ATPase required during meiosis for the formation of crossover recombination intermediates. Binds DNA: preferentially binds to single-stranded DNA and DNA branched structures (PubMed:29742103). Does not show nuclease activity in vitro, but shows ATPase activity, which is stimulated by the presence...
Schlagworte: Protein shortage in chiasmata 1 ortholog, Protein ZIP2 homolog, MZIP2, Recombinant Human SHOC1 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 18.5 kD
ab 90,00 €
Bewerten
SHOC1 PrEST Antigen
SHOC1 PrEST Antigen

Artikelnummer: ATA-APrEST95882.100

PrEST Antigen SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84, FLJ32779, MZIP2, Zip2, Antigen sequence: LTNKHGIEDIGDIKFSSTEILTIQSQSEPEECSKPGELEMPLTPLFLTCQHSSVNSLRTELQTFPLSPVCKI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: ATPase...
Schlagworte: MZIP2, Protein ZIP2 homolog, Protein shortage in chiasmata 1 ortholog
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
SHOC1 (human), recombinant protein
SHOC1 (human), recombinant protein

Artikelnummer: ABS-PP-7130-L.100

Protein function: ATPase required during meiosis for the formation of crossover recombination intermediates. Binds DNA: preferentially binds to single-stranded DNA and DNA branched structures (PubMed:29742103). Does not show nuclease activity in vitro, but shows ATPase activity, which is stimulated by the presence...
Schlagworte: Protein shortage in chiasmata 1 ortholog, Protein ZIP2 homolog, MZIP2, Recombinant Human SHOC1 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 18.5 kD
ab 115,00 €
Bewerten