Zu "Q5VXU9" wurden 4 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-SHOC1
Artikelnummer: ATA-HPA052214.100
Polyclonal Antibody against Human SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84, FLJ32779, MZIP2, Zip2, Validated applications: ICC, Uniprot ID: Q5VXU9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: ATPase required...
| Schlagworte: | Anti-MZIP2, Anti-Protein ZIP2 homolog, Anti-Protein shortage in chiasmata 1 ortholog |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
SHOC1 (human), recombinant protein
Artikelnummer: ABS-PP-7130-L.100
Protein function: ATPase required during meiosis for the formation of crossover recombination intermediates. Binds DNA: preferentially binds to single-stranded DNA and DNA branched structures (PubMed:29742103). Does not show nuclease activity in vitro, but shows ATPase activity, which is stimulated by the presence...
| Schlagworte: | Protein shortage in chiasmata 1 ortholog, Protein ZIP2 homolog, MZIP2, Recombinant Human SHOC1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.5 kD |
ab 115,00 €
SHOC1 (human), recombinant protein
Artikelnummer: ABS-PP-7130.100
Protein function: ATPase required during meiosis for the formation of crossover recombination intermediates. Binds DNA: preferentially binds to single-stranded DNA and DNA branched structures (PubMed:29742103). Does not show nuclease activity in vitro, but shows ATPase activity, which is stimulated by the presence...
| Schlagworte: | Protein shortage in chiasmata 1 ortholog, Protein ZIP2 homolog, MZIP2, Recombinant Human SHOC1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.5 kD |
ab 90,00 €
SHOC1 PrEST Antigen
Artikelnummer: ATA-APrEST95882.100
PrEST Antigen SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84, FLJ32779, MZIP2, Zip2, Antigen sequence: LTNKHGIEDIGDIKFSSTEILTIQSQSEPEECSKPGELEMPLTPLFLTCQHSSVNSLRTELQTFPLSPVCKI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: ATPase...
| Schlagworte: | MZIP2, Protein ZIP2 homolog, Protein shortage in chiasmata 1 ortholog |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
