Zu "Q5VVC0" wurden 4 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-C1orf146
Artikelnummer: ATA-HPA074051.100
Polyclonal Antibody against Human C1orf146, Gene description: chromosome 1 open reading frame 146, Alternative Gene Names: SPO16, Validated applications: ICC, Uniprot ID: Q5VVC0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Plays a key role in...
| Schlagworte: | Anti-C1orf146, Anti-Protein SPO16 homolog, Anti-Synaptonemal complex reinforcing element |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-CA146
Artikelnummer: ELK-ES17911.100
Protein function: Plays a key role in reinforcing the integrity of the central element of the synaptonemal complex (SC) thereby stabilizing SC, ensuring progression of meiotic prophase I in male and female germ cells. Promotes homologous recombination and crossing- over in meiotic prophase I via its association with...
| Schlagworte: | Anti-C1orf146, Anti-Protein SPO16 homolog, Anti-Synaptonemal complex reinforcing element, CA146 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
C1orf146 (Vector Vector will be determined during the...
Artikelnummer: CSB-CL716575HU.10
Length: 543 Sequence: atggctgaaa gtggaaaaga aaaaataaaa tggacaacca ccattattat tagctcatct cttaagagtt atgaagttgc aactgcccta gaaaatcgaa gccacaaagt tcgatattca gattcagtgg aaaatggatc aattatattt tctctttctg gagttgcatt tttattaatg gatactaagg aatgtcttct gtcaactgaa gaaatatttc tagccaaaat tgagaaattt attaacattc accaaaatag...
| Schlagworte: | C1orf146, Protein SPO16 homolog, Synaptonemal complex reinforcing element |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
C1orf146 PrEST Antigen
Artikelnummer: ATA-APrEST96068.100
PrEST Antigen C1orf146, Gene description: chromosome 1 open reading frame 146, Alternative Gene Names: SPO16, Antigen sequence: VNAINLMCTIAKTTSKPYIDSICYRMITAKAYIIEQSPVWKTLQKIKLNSDSVNP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Plays a key role in reinforcing the...
| Schlagworte: | C1orf146, Protein SPO16 homolog, Synaptonemal complex reinforcing element |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
