Zu "Q5T5X7" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-BEND3
Artikelnummer: ATA-HPA017891.100
Protein function: Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its USP21-mediated deubiquitination...
| Schlagworte: | Anti-BEND3, Anti-KIAA1553, Anti-BEN domain-containing protein 3 |
| Anwendung: | IHC, ChIP |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
BEN domain-containing protein 3 (BEND3), partial, human,...
Artikelnummer: CSB-YP729205HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 328-461aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: CLPQLNDFFS RFWAQREMED SQPSGQVASF FEAEQVDPGH FLDNKDQEEA LSLDRSSTIA SDHVVDTQDL TEFLDEASSP GEFAVFLLHR LFPELFDHRK LGEQYSCYGD GGKQELDPQR LQIIRNYTEI YFPD....
| Schlagworte: | BEND3, KIAA1553, BEN domain-containing protein 3, Recombinant Human BEN domain-containing protein 3 (BEND3), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | human |
| MW: | 17.5 kD |
ab 242,00 €
BEN domain-containing protein 3 (BEND3), partial, human,...
Artikelnummer: CSB-EP729205HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 328-461aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: CLPQLNDFFS RFWAQREMED SQPSGQVASF FEAEQVDPGH FLDNKDQEEA LSLDRSSTIA SDHVVDTQDL TEFLDEASSP GEFAVFLLHR LFPELFDHRK LGEQYSCYGD GGKQELDPQR LQIIRNYTEI YFPD. Purity:...
| Schlagworte: | BEND3, KIAA1553, BEN domain-containing protein 3, Recombinant Human BEN domain-containing protein 3 (BEND3), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 42.5 kD |
ab 219,00 €
Anti-BEND3, CT (BEND3, KIAA1553, BEN domain-containing...
Artikelnummer: 032493.200
Applications:, Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product,...
| Schlagworte: | Anti-BEND3, Anti-KIAA1553, Anti-BEN domain-containing protein 3 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
BEND3, Recombinant, Human, aa328-461, GST-Tag (BEN...
Artikelnummer: 372435.1
Source:, Recombinant protein corresponding to aa328-461 from human BEND3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.5kD, AA Sequence: CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD, Storage and...
| Schlagworte: | BEND3, KIAA1553, BEN domain-containing protein 3 |
| MW: | 42,5 |
ab 603,00 €
BEND3 PrEST Antigen
Artikelnummer: ATA-APrEST72814.100
Protein function: Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its USP21-mediated deubiquitination...
| Schlagworte: | BEND3, KIAA1553, BEN domain-containing protein 3 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
BEND3, Recombinant, Human, aa328-461, His-Tag (BEN...
Artikelnummer: 372436.100
Source:, Recombinant protein corresponding to aa328-461 from human BEND3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.5kD, AA Sequence: CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD, Storage and...
| Schlagworte: | BEND3, KIAA1553, BEN domain-containing protein 3 |
| MW: | 17,5 |
ab 557,00 €
BEND3 (Vector Vector will be determined during the...
Artikelnummer: CSB-CL729205HU.10
Length: 2487 Sequence: ATGAACTCAA CTGAATTCAC CGAAGATGTA GAAGAAGTTC TAAAAAGTAT CACTGTGAAA GTGGAGACAG AGGCTGAAGA TGCTGCTCTG GACTGCTCCG TGAATTCCAG GACTTCTGAG AAGCACTCTG TGGACAGCGT CCTCACTGCC CTGCAGGACT CCAGCAAACG AAAGCAGCTG GTCAGCGATG GCCTGCTAGA CTCTGTCCCC GGCGTGAAGA GGAGGCGGCT GATCCCCGAG GCTCTCCTAG CAGGCATGCG...
| Schlagworte: | BEND3, KIAA1553, BEN domain-containing protein 3 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
482,00 €
BEND3 (human), recombinant protein
Artikelnummer: ABS-PP-3154.100
Protein function: Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its USP21-mediated deubiquitination...
| Schlagworte: | BEN domain-containing protein 3, Recombinant Human BEND3 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 14 kD |
ab 90,00 €
Anti-BEND3
Artikelnummer: CSB-PA729205ZA01HU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-BEND3, Anti-KIAA1553, Anti-BEN domain-containing protein 3, BEND3 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Homo sapiens (Human) |
ab 1.529,00 €
BEND3 (human), recombinant protein
Artikelnummer: ABS-PP-3154-L.100
Protein function: Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its USP21-mediated deubiquitination...
| Schlagworte: | BEN domain-containing protein 3, Recombinant Human BEND3 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 14 kD |
ab 115,00 €