Zu "Q5EBL8" wurden 17 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-PDZD11
Artikelnummer: G-PACO36262.50
PDZD11 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. PDZD11 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is...
| Schlagworte: | Anti-AIPP1, Anti-PDZD11, Anti-HSPC227, Anti-ATPase-interacting PDZ protein, Anti-PDZ domain-containing protein 11,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
313,00 €
Anti-PDZD11
Artikelnummer: ATA-HPA003972.100
Protein function: Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10- binding protein TSPAN33. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence...
| Schlagworte: | Anti-AIPP1, Anti-PDZD11, Anti-HSPC227, Anti-ATPase-interacting PDZ protein, Anti-PDZ domain-containing protein 11,... |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
PDZD11 PDZ Domain
Artikelnummer: NZY-PD00941
The protein is provided in 35 mM NaHepes buffer, pH 7.5, 750 mM NaCl, 200 mM imidazol, 3.5 mM CaCl2 and 25% (v/v) glycerol, at a 0.5 mg/mL concentration.Sequence: NNELTQFLPR TITLKKPPGA QLGFNIRGGK ASQLGIFISK VIPDSDAHRA GLQEGDQVLA VNDVDFQDIE HSKAVEILKT AREISMRVRF FP. Components: PDZD11 PDZ Domain. Shipping Conditions:...
| Schlagworte: | AIPP1, PDZD11, HSPC227, ATPase-interacting PDZ protein, PDZ domain-containing protein 11, PMCA-interacting single-PDZ... |
| Anwendung: | Protein binding |
| MW: | 13,15 kD |
ab 259,00 €
PDZ domain-containing protein 11 (PDZD11), human,...
Artikelnummer: CSB-EP707840HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-140aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MDSRIPYDDY PVVFLPAYEN PPAWIPPHER VHHPDYNNEL TQFLPRTITL KKPPGAQLGF NIRGGKASQL GIFISKVIPD SDAHRAGLQE GDQVLAVNDV DFQDIEHSKA VEILKTAREI SMRVRFFPYN...
| Schlagworte: | AIPP1, PDZD11, HSPC227, ATPase-interacting PDZ protein, PDZ domain-containing protein 11, PMCA-interacting single-PDZ... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 32.1 kD |
ab 219,00 €
PDZD11 Protein, Human, Recombinant (His)
Artikelnummer: TGM-TMPY-01880-100ug
Description: PDZ domain-containing protein 11, also known as AIPP1a, PISP, PDZD11 and PDZK11, is a cytosolic protein that contains one PDZ (DHR) domain. PDZD11 bears resemblance to members of the MALS / VELIS family of proteins. It contains but one PDZ domain that apparently interacts with the C-terminus of partner...
| Schlagworte: | PISP, AIPP1, PDZK11, PDZ domain containing 11 |
| MW: | 16.9 kD |
768,00 €
PDZD11 Protein, Human, Recombinant (His)
Artikelnummer: TGM-TMPY-01880-10ug
Description: PDZ domain-containing protein 11, also known as AIPP1a, PISP, PDZD11 and PDZK11, is a cytosolic protein that contains one PDZ (DHR) domain. PDZD11 bears resemblance to members of the MALS / VELIS family of proteins. It contains but one PDZ domain that apparently interacts with the C-terminus of partner...
| Schlagworte: | AIPP1 , PISP , PDZ domain containing 11 , PDZK11 |
| MW: | 16.9 kD |
ab 75,00 €
PDZD11, Human PDZ domain containing 11, Real Time PCR...
Artikelnummer: VHPS-6761
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | PDZK11, PDZD11, HSPC227, PDZ domain-containing protein 11 |
| Anwendung: | RNA quantification |
45,00 €
Anti-PDZD11 (PDZ Domain-containing Protein 11, AIPP1a, PISP)
Artikelnummer: P3129-85.100
PDZD11 (PDZ domain-containing protein 11, also AIPP1a and PISP) is a 17kD cytosolic protein that bears resemblance to members of the MALS/VELIS family of proteins. It is ubiquitously expressed, and appears to target calcium and copper ATPases to basolateral cell membranes. Human PDZD11 is 140aa in length. It...
| Schlagworte: | Anti-PDZK11, Anti-HSPC227, Anti-PDZ domain-containing protein 11 |
| Anwendung: | ELISA, WB |
| Wirt: | Goat |
| Spezies-Reaktivität: | human |
1.039,00 €
PDZD11, Recombinant, Human, aa1-140, His-SUMO-Tag (PDZ...
Artikelnummer: 374656.1
Source:, Recombinant protein corresponding to aa1-140 from human PDZD11, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.1kD, AA Sequence: MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH,...
| Schlagworte: | AIPP1, PDZD11, HSPC227, ATPase-interacting PDZ protein, PDZ domain-containing protein 11, PMCA-interacting single-PDZ... |
| MW: | 32,1 |
ab 603,00 €
PDZD11 PrEST Antigen
Artikelnummer: ATA-APrEST74533.100
Protein function: Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10- binding protein TSPAN33. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | AIPP1, PDZD11, HSPC227, ATPase-interacting PDZ protein, PDZ domain-containing protein 11, PMCA-interacting single-PDZ... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Recombinant Human PDZD11 / PDZK11 / PISP Protein (His tag)
Artikelnummer: E-PKSH030879.100
| Ursprungsart: | human |
924,00 €
Recombinant Human PDZD11/PDZK11/PISP Protein (His Tag)...
Artikelnummer: G-RPES3254.100
Human PDZD11/PDZK11/PISP Recombinant Protein (RPES3254) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10- binding...
| Schlagworte: | AIPP1, PDZD11, HSPC227, ATPase-interacting PDZ protein, PDZ domain-containing protein 11, PMCA-interacting single-PDZ... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
1.471,00 €