- Suchergebnis für Q29TV8
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q29TV8" wurden 6 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
NEU
Artikelnummer: ELK-ELK6260MS.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Schlagworte: | Gkn2, Blottin, Gastrokine-2 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 374,00 €
Artikelnummer: ELK-ELK6260.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Schlagworte: | Blot, Gkn2, Blottin, Gastrokine-2 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 374,00 €
Artikelnummer: G-AEKE09661.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Schlagworte: | Gkn2, Blottin, Gastrokine-2 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
694,00 €
Artikelnummer: G-AEKE09660.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Schlagworte: | Gkn2, Blottin, Gastrokine-2 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
694,00 €
Artikelnummer: 154742.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q29TV8, Fragment: Lys21~Leu184 (Accession No: Q29TV8), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-KEVFNIFVPG NNGGNVQETV TIDNQENTAT INIHSGSCSS TTIFDYKHGY IASRVLSRRA...
ab 512,00 €
Artikelnummer: G-RTFI00818.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
698,00 €