Zu "Q29TV8" wurden 6 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
NEU
Rat GKN2 (Gastrokine 2) Microsample ELISA Kit
Artikelnummer: ELK-ELK6260MS.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Schlagworte: | Gkn2, Blottin, Gastrokine-2 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 374,00 €
Rat GKN2 (Gastrokine 2) ELISA Kit
Artikelnummer: ELK-ELK6260.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Schlagworte: | Blot, Gkn2, Blottin, Gastrokine-2 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 374,00 €
Rat GKN2 (Gastrokine 2) ELISA (Small Sample Volume)
Artikelnummer: G-AEKE09661.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Schlagworte: | Gkn2, Blottin, Gastrokine-2 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
694,00 €
Rat GKN2 (Gastrokine 2) ELISA Kit
Artikelnummer: G-AEKE09660.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GKN2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GKN2. Next,...
| Schlagworte: | Gkn2, Blottin, Gastrokine-2 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
694,00 €
Gastrokine 2 (GKN2) Recombinant, Rat
Artikelnummer: 154742.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q29TV8, Fragment: Lys21~Leu184 (Accession No: Q29TV8), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-KEVFNIFVPG NNGGNVQETV TIDNQENTAT INIHSGSCSS TTIFDYKHGY IASRVLSRRA...
ab 512,00 €
Rat GKN2 / Gastrokine 2 ELISA Kit
Artikelnummer: G-RTFI00818.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
698,00 €