Zu "Q15415" wurden 12 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-RBMY1F
Anti-RBMY1F

Artikelnummer: ATA-HPA053147.100

Protein function: RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity...
Schlagworte: Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y...
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
RNA-binding motif protein, Y chromosome, family 1 member F/J (RBMY1F), human, recombinant
RNA-binding motif protein, Y chromosome, family 1 member...

Artikelnummer: CSB-EP614891HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-496aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MVEADHPGKL FIGGLNRETN EKMLKAVFGK HGPISEVLLI KDRTSKSRGF AFITFENPAD AKNAAKDMNG TSLHGKAIKV EQAKKPSFQS GGRRRPPASS RNRSPSGSLR SARGSSGGTR GWLPSHEGHL...
Schlagworte: YRRM2, RBMY1J, RBMY1F, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J,...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 71.7 kD
ab 219,00 €
Bewerten
Anti-RBMY1F
Anti-RBMY1F

Artikelnummer: ATA-HPA057723.100

Polyclonal Antibody against Human RBMY1F, Gene description: RNA binding motif protein Y-linked family 1 member F, Alternative Gene Names: MGC33094, Validated applications: ICC, Uniprot ID: Q15415, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: RNA-binding...
Schlagworte: Anti-YRRM2, Anti-RBMY1F, Anti-RBMY1J, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
RBMY1F, Recombinant, Human, aa1-496, His-SUMO-Tag (RNA-binding Motif Protein, Y Chromosome, Family 1
RBMY1F, Recombinant, Human, aa1-496, His-SUMO-Tag...

Artikelnummer: 375005.1

RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. Source: Recombinant protein corresponding to aa1-496 from human RBMY1F, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~71.7kD, AA...
Schlagworte: YRRM2, RBMY1F, RBMY1J, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J
MW: 71,7
ab 603,00 €
Bewerten
RBMY1F PrEST Antigen
RBMY1F PrEST Antigen

Artikelnummer: ATA-APrEST89144.100

Protein function: RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: YRRM2, RBMY1J, RBMY1F, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-RBMY1F
Anti-RBMY1F

Artikelnummer: G-CAB16604.20

Protein function: RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. [The UniProt Consortium]
Schlagworte: Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: rat
149,00 €
Bewerten
RBMY1F (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
RBMY1F (Vector Vector will be determined during the...

Artikelnummer: CSB-CL614891HU.10

Length: 1491 Sequence: atggtagaag cagatcatcc tggcaagctt ttcattggtg gcctcaatag agaaaccaat gagaagatgc ttaaagcagt atttgggaaa catggtccca tatcagaagt tcttttgata aaggatcgaa ccagcaaatc cagaggcttt gcatttatta cttttgagaa ccctgcagat gctaagaatg ctgcgaaaga tatgaatgga acgtctttgc atggaaaagc aataaaagta gaacaagcca agaaaccatc...
Schlagworte: YRRM2, RBMY1J, RBMY1F, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
176,00 €
Bewerten
Anti-RBMY1F
Anti-RBMY1F

Artikelnummer: CSB-PA614891LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RBMY1F. Antigen Species: Human
Schlagworte: Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y...
Anwendung: ELISA, WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-RBMY1F, HRP conjugated
Anti-RBMY1F, HRP conjugated

Artikelnummer: CSB-PA614891LB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RBMY1F. Antigen Species: Human
Schlagworte: Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-RBMY1F, FITC conjugated
Anti-RBMY1F, FITC conjugated

Artikelnummer: CSB-PA614891LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RBMY1F. Antigen Species: Human
Schlagworte: Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y...
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-RBMY1F, Biotin conjugated
Anti-RBMY1F, Biotin conjugated

Artikelnummer: CSB-PA614891LD01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RBMY1F. Antigen Species: Human
Schlagworte: Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
RBMY1F PrEST Antigen
RBMY1F PrEST Antigen

Artikelnummer: ATA-APrEST95767.100

PrEST Antigen RBMY1F, Gene description: RNA binding motif protein Y-linked family 1 member F, Alternative Gene Names: MGC33094, Antigen sequence: WRNDRMSTRHDGYATNDGNHPSCQETRDYA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding protein which may be involved in...
Schlagworte: YRRM2, RBMY1J, RBMY1F, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten