Zu "Q13867" wurden 18 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-BLMH
Anti-BLMH

Artikelnummer: ARG59580.100

Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]
Schlagworte: Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase
Anwendung: ICC, IF, WB
Wirt: Rabbit
Spezies-Reaktivität: human, rat
707,00 €
Bewerten
Anti-BLMH
Anti-BLMH

Artikelnummer: ARG59631.100

Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]
Schlagworte: Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase
Anwendung: IHC (paraffin), WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
616,00 €
Bewerten
Anti-BLMH
Anti-BLMH

Artikelnummer: ATA-HPA064307.100

Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]...
Schlagworte: Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
Anti-BLMH
Anti-BLMH

Artikelnummer: ATA-HPA039548.100

Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]...
Schlagworte: Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase
Anwendung: IHC, WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 246,00 €
Bewerten
Human BLMH (Bleomycin Hydrolase) ELISA Kit
Human BLMH (Bleomycin Hydrolase) ELISA Kit

Artikelnummer: ELK-ELK3153.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human BLMH. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human BLMH. Next,...
Schlagworte: BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase
Anwendung: ELISA
Spezies-Reaktivität: human
ab 374,00 €
Bewerten
BLMH, aa1-455, Recombinant, Human (Bleomycin Hydrolase, BH, BLM Hydrolase, BMH)
BLMH, aa1-455, Recombinant, Human (Bleomycin Hydrolase,...

Artikelnummer: B2105-61.100

BLMH is a member of the papain superfamily of the cysteine protease and the peptidase C1 family. It is a cytoplasmic cysteinepeptidase commonly found as a homohexamer. The normal physiological role of BLMH is unknown, but it protects normal and malignant cells from the glycopeptide antitumor drug BLM. It catalyzes...
Schlagworte: BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase
Ursprungsart: human
ab 636,00 €
Bewerten
Human Bleomycin hydrolase (BLMH) ELISA kit
Human Bleomycin hydrolase (BLMH) ELISA kit

Artikelnummer: CSB-EL002716HU.48

Sample Types: serum, plasma, tissue homogenates, cell lysates Detection Range: 28 pg/mL-1800 pg/mL Sensitivity: 7 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: The normal physiological role of BLM hydrolase is unknown,...
Schlagworte: BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase
Anwendung: ELISA, Sandwich ELISA
Spezies-Reaktivität: human
ab 581,00 €
Bewerten
BLMH, Human bleomycin hydrolase, Real Time PCR Primer Set
BLMH, Human bleomycin hydrolase, Real Time PCR Primer Set

Artikelnummer: VHPS-837

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase
Anwendung: RNA quantification
45,00 €
Bewerten
Bleomycin Hydrolase, Recombinant, Human (BH, BLMH, BMH, BLM Hydrolase)
Bleomycin Hydrolase, Recombinant, Human (BH, BLMH, BMH,...

Artikelnummer: B2105-60M.10

Bleomycin Hydrolase (BLMH) is a cysteine peptidase of the papain superfamily. It is named for its ability to hydrolyze the antitumor agent bleomycin and inactivate it. It has a papain­like catalytic triad (Cys­His­Asp) with optimum activity at neutral pH. In mammals it is expressed ubiquitously in all types of...
Schlagworte: EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase
MW: 53 kD
1.096,00 €
Bewerten
Bleomycin Hydrolase (BLMH) Recombinant, Human
Bleomycin Hydrolase (BLMH) Recombinant, Human

Artikelnummer: 153685.10

Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q13867, Fragment: Met213~Trp447 (Accession No: Q13867), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-MEEIFRVV CICLGNPPET FTWEYRDKDK NYQKIGPITP LEFYREHVKP LFNMEDKICL...
ab 454,00 €
Bewerten
Anti-Bleomycin hydrolase / BLMH
Anti-Bleomycin hydrolase / BLMH

Artikelnummer: NSJ-F54739-0.08ML

In 1X PBS, pH 7.4, with 0.09% sodium azide. The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity (By...
Schlagworte: Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase, Bleomycin hydrolase Antibody / BLMH
Anwendung: IHC (paraffin), WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 361,00 €
Bewerten
BLMH PrEST Antigen
BLMH PrEST Antigen

Artikelnummer: ATA-APrEST75558.100

Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]...
Schlagworte: BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
1 von 2 Seiten