- Suchergebnis für Q13867
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q13867" wurden 18 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ARG59580.100
Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]
| Schlagworte: | Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase |
| Anwendung: | ICC, IF, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat |
707,00 €
Artikelnummer: ARG59631.100
Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]
| Schlagworte: | Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase |
| Anwendung: | IHC (paraffin), WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
616,00 €
Artikelnummer: ATA-HPA064307.100
Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]...
| Schlagworte: | Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: ATA-HPA039548.100
Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]...
| Schlagworte: | Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 246,00 €
Artikelnummer: ELK-ELK3153.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human BLMH. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human BLMH. Next,...
| Schlagworte: | BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 374,00 €
Artikelnummer: B2105-61.100
BLMH is a member of the papain superfamily of the cysteine protease and the peptidase C1 family. It is a cytoplasmic cysteinepeptidase commonly found as a homohexamer. The normal physiological role of BLMH is unknown, but it protects normal and malignant cells from the glycopeptide antitumor drug BLM. It catalyzes...
| Schlagworte: | BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase |
| Ursprungsart: | human |
ab 636,00 €
Artikelnummer: CSB-EL002716HU.48
Sample Types: serum, plasma, tissue homogenates, cell lysates Detection Range: 28 pg/mL-1800 pg/mL Sensitivity: 7 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: The normal physiological role of BLM hydrolase is unknown,...
| Schlagworte: | BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | human |
ab 581,00 €
Artikelnummer: VHPS-837
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: B2105-60M.10
Bleomycin Hydrolase (BLMH) is a cysteine peptidase of the papain superfamily. It is named for its ability to hydrolyze the antitumor agent bleomycin and inactivate it. It has a papainlike catalytic triad (CysHisAsp) with optimum activity at neutral pH. In mammals it is expressed ubiquitously in all types of...
| Schlagworte: | EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase |
| MW: | 53 kD |
953,00 €
Artikelnummer: 153685.10
Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q13867, Fragment: Met213~Trp447 (Accession No: Q13867), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-MEEIFRVV CICLGNPPET FTWEYRDKDK NYQKIGPITP LEFYREHVKP LFNMEDKICL...
ab 454,00 €
Artikelnummer: NSJ-F54739-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity (By...
| Schlagworte: | Anti-BH, Anti-BMH, Anti-BLMH, EC=3.4.22.40, Anti-BLM hydrolase, Anti-Bleomycin hydrolase, Bleomycin hydrolase Antibody / BLMH |
| Anwendung: | IHC (paraffin), WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 361,00 €
Artikelnummer: ATA-APrEST75558.100
Protein function: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B- aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. [The UniProt Consortium]...
| Schlagworte: | BH, BMH, BLMH, EC=3.4.22.40, BLM hydrolase, Bleomycin hydrolase |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €