Zu "Q04745" wurden 16 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
-10 %
Rabattaktion
Pig IL4 (Interleukin 4) ELISA Kit
Pig IL4 (Interleukin 4) ELISA Kit

Artikelnummer: ELK-ELK5717.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig IL4. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig IL4. Next, Avidin...
Schlagworte: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
Anwendung: ELISA
Spezies-Reaktivität: swine
470,00 € ab 423,00 €
Bewerten
Porcine IL4 ELISA Kit
Porcine IL4 ELISA Kit

Artikelnummer: ARG81290.96

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Schlagworte: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
Anwendung: ELISA
Spezies-Reaktivität: swine
824,00 €
Bewerten
IL-4 (pig) ELISA kit
IL-4 (pig) ELISA kit

Artikelnummer: BR-A05420.96

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Schlagworte: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
553,00 €
Bewerten
Porcine IL4 ELISA Kit
Porcine IL4 ELISA Kit

Artikelnummer: G-PRFI00098.96

Anwendung: ELISA
Spezies-Reaktivität: swine
641,00 €
Bewerten
Interleukin-4 (IL-4) (swine) Do-It-Yourself ELISA
Interleukin-4 (IL-4) (swine) Do-It-Yourself ELISA

Artikelnummer: DIY0726S-003

The swine IL-4 Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a swine IL-4 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for...
Schlagworte: IL-4, B-cell stimulatory factor 1, BSF-1, Lympphocyte stimulatory factor 1
Anwendung: ELISA
Spezies-Reaktivität: swine
ab 1.056,00 €
Bewerten
Anti-Interleukin-4 (IL-4) (swine)
Anti-Interleukin-4 (IL-4) (swine)

Artikelnummer: PB0475S-100

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Schlagworte: Anti-IL4, Anti-IL-4, Anti-BSF-1, Anti-Interleukin-4, Anti-B-cell stimulatory factor 1, Anti-Lymphocyte stimulatory factor 1
Anwendung: ELISA
Wirt: Goat
Spezies-Reaktivität: swine, bovine, dolphin, feline
521,00 €
Bewerten
-20 %
Rabattaktion
Pig IL4 recombinant protein (Active)
Pig IL4 recombinant protein (Active)

Artikelnummer: ARG70204.100

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Schlagworte: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
Anwendung: SDS-PAGE, Cell culture
Ursprungsart: swine
336,00 € ab 268,80 €
Bewerten
Porcine IL-4(Interleukin 4) ELISA Kit
Porcine IL-4(Interleukin 4) ELISA Kit

Artikelnummer: E-EL-P3006.24

Colormetric. Detection Range: 1.56-100 pg/mL. Sensitivity: 0.89 pg/mL. Recovery rate: 80%-120%. Precision: Both intra-CV and inter-CV are < 10%.
Schlagworte: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1
Anwendung: ELISA
Spezies-Reaktivität: swine
ab 119,00 €
Bewerten
IL-4 protein(N-His)(active) (recombinant swine)
IL-4 protein(N-His)(active) (recombinant swine)

Artikelnummer: E-PKSS000004.5

Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.6 ng/mL. Sequence: MGLTSQLIPTLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC. Fusion tag: N-His Endotoxin: Please contact us for more...
Schlagworte: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1, Recombinant Swine IL-4...
Anwendung: Active, cell culture
Exprimiert in: E.coli
Ursprungsart: swine
MW: 15.85 kD
234,00 €
Bewerten
Anti-Interleukin-4 (IL-4) (swine), Biotin conjugated
Anti-Interleukin-4 (IL-4) (swine), Biotin conjugated

Artikelnummer: PBB0484S-050

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Schlagworte: Anti-IL4, Anti-IL-4, Anti-BSF-1, Anti-Interleukin-4, Anti-B-cell stimulatory factor 1, Anti-Lymphocyte stimulatory factor 1
Anwendung: ELISA
Wirt: Goat
Spezies-Reaktivität: swine, bovine, dolphin, feline
535,00 €
Bewerten
IL-4, swine recombinant (rpoIL-4)
IL-4, swine recombinant (rpoIL-4)

Artikelnummer: RP0300S-100

Produced in Yeast. Amino acid sequence: HKCDITLQEI IKTLNILTAR KNSCMELPVT DVFAAPENTT EKETFCRAST VLRHIYRHHT CMKSLLSGLD RNLSSMANMT CSVHEAKKST LKDFLERLKT IMKEKYSKC (109).
Schlagworte: IL-4, B-cell stimulatory factor 1, BSF-1, Lympphocyte stimulatory factor 1
Anwendung: Bioassays
Exprimiert in: Yeast
Ursprungsart: swine
MW: 12,5 kD
ab 206,00 €
Bewerten
Interleukin 4 (IL4) Recombinant, Porcine
Interleukin 4 (IL4) Recombinant, Porcine

Artikelnummer: 155434.10

Accession Number: Q04745/
ab 431,00 €
Bewerten
1 von 2 Seiten