- Suchergebnis für Q04745
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q04745" wurden 16 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
-10 %
Rabattaktion
Artikelnummer: ELK-ELK5717.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig IL4. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig IL4. Next, Avidin...
Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
Anwendung: | ELISA |
Spezies-Reaktivität: | swine |
470,00 €
ab 423,00 €
Artikelnummer: ARG81290.96
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
Anwendung: | ELISA |
Spezies-Reaktivität: | swine |
824,00 €
Artikelnummer: BR-A05420.96
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
553,00 €
Artikelnummer: G-PRFI00098.96
Anwendung: | ELISA |
Spezies-Reaktivität: | swine |
641,00 €
Artikelnummer: DIY0726S-003
The swine IL-4 Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a swine IL-4 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for...
Schlagworte: | IL-4, B-cell stimulatory factor 1, BSF-1, Lympphocyte stimulatory factor 1 |
Anwendung: | ELISA |
Spezies-Reaktivität: | swine |
ab 1.056,00 €
Artikelnummer: PB0475S-100
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Schlagworte: | Anti-IL4, Anti-IL-4, Anti-BSF-1, Anti-Interleukin-4, Anti-B-cell stimulatory factor 1, Anti-Lymphocyte stimulatory factor 1 |
Anwendung: | ELISA |
Wirt: | Goat |
Spezies-Reaktivität: | swine, bovine, dolphin, feline |
521,00 €
-20 %
Rabattaktion
Artikelnummer: ARG70204.100
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
Anwendung: | SDS-PAGE, Cell culture |
Ursprungsart: | swine |
336,00 €
ab 268,80 €
Artikelnummer: E-EL-P3006.24
Colormetric. Detection Range: 1.56-100 pg/mL. Sensitivity: 0.89 pg/mL. Recovery rate: 80%-120%. Precision: Both intra-CV and inter-CV are < 10%.
Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
Anwendung: | ELISA |
Spezies-Reaktivität: | swine |
ab 119,00 €
Artikelnummer: E-PKSS000004.5
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.6 ng/mL. Sequence: MGLTSQLIPTLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC. Fusion tag: N-His Endotoxin: Please contact us for more...
Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1, Recombinant Swine IL-4... |
Anwendung: | Active, cell culture |
Exprimiert in: | E.coli |
Ursprungsart: | swine |
MW: | 15.85 kD |
234,00 €
Artikelnummer: PBB0484S-050
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Schlagworte: | Anti-IL4, Anti-IL-4, Anti-BSF-1, Anti-Interleukin-4, Anti-B-cell stimulatory factor 1, Anti-Lymphocyte stimulatory factor 1 |
Anwendung: | ELISA |
Wirt: | Goat |
Spezies-Reaktivität: | swine, bovine, dolphin, feline |
535,00 €
Artikelnummer: RP0300S-100
Produced in Yeast. Amino acid sequence: HKCDITLQEI IKTLNILTAR KNSCMELPVT DVFAAPENTT EKETFCRAST VLRHIYRHHT CMKSLLSGLD RNLSSMANMT CSVHEAKKST LKDFLERLKT IMKEKYSKC (109).
Schlagworte: | IL-4, B-cell stimulatory factor 1, BSF-1, Lympphocyte stimulatory factor 1 |
Anwendung: | Bioassays |
Exprimiert in: | Yeast |
Ursprungsart: | swine |
MW: | 12,5 kD |
ab 206,00 €
Artikelnummer: 155434.10
Accession Number: Q04745/
ab 431,00 €