- Suchergebnis für Q00968
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q00968" wurden 8 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ELK-ELK5718.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig EGF. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig EGF. Next, Avidin...
| Schlagworte: | EGF |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
ab 481,00 €
Artikelnummer: G-AEKE09310.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig EGF. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig EGF. Next, Avidin...
| Schlagworte: | EGF, Pro-epidermal growth factor |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | bovine |
801,00 €
Artikelnummer: CR-C03020-100UG
Sequence: MNSYSECPPS HDGYCLHGGV CMYIEAVDSY ACNCVFGYVG ERCQHRDLKW with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell...
| Schlagworte: | EGF |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
ab 618,00 €
Artikelnummer: RP1232S-025
Produced in Yeast. Amino acid sequence: NSYSECPPSH DGYCLHGGVC MYIEAVDSYA CNCVFGYVGE RCQHRDLKWW ELR (53).
| Schlagworte: | EGF |
| Anwendung: | Bioassays |
| Exprimiert in: | Yeast |
| Ursprungsart: | swine |
| MW: | 6,1 kD |
ab 233,00 €
Artikelnummer: 154449.10
Source:, Recombinant Porcine from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q00968, Fragment: Ala45~His275 (Accession No: Q00968), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-APFLIF SHGNSIFRID LEGTNHEQLV ADAGISVLMD FHYNEERIYW VDLERQLLQR...
ab 445,00 €
Artikelnummer: E-PKSS000015.100
Sequence:...
| Schlagworte: | EGF, Recombinant Swine EGF protein(N-His) |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 134.35 kD |
ab 192,00 €
Artikelnummer: G-AEFI00792.96
ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 3.125-200µg/mL. Sensitivity: 1.875µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and...
| Schlagworte: | EGF |
| Anwendung: | Sandwich ELISA, Double Antibody |
| Spezies-Reaktivität: | swine |
698,00 €
Artikelnummer: G-RPES6858.100
Protein function: EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel...
| Schlagworte: | EGF |
| Exprimiert in: | E.coli |
306,00 €