Zu "Q00968" wurden 8 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Pig EGF (Epidermal Growth Factor) ELISA Kit
Pig EGF (Epidermal Growth Factor) ELISA Kit

Artikelnummer: ELK-ELK5718.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig EGF. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig EGF. Next, Avidin...
Schlagworte: EGF
Anwendung: ELISA
Spezies-Reaktivität: swine
ab 481,00 €
Bewerten
Pig EGF (Epidermal Growth Factor) ELISA Kit
Pig EGF (Epidermal Growth Factor) ELISA Kit

Artikelnummer: G-AEKE09310.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig EGF. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig EGF. Next, Avidin...
Schlagworte: EGF, Pro-epidermal growth factor
Anwendung: ELISA
Spezies-Reaktivität: bovine
801,00 €
Bewerten
EGF, Swine
EGF, Swine

Artikelnummer: CR-C03020-100UG

Sequence: MNSYSECPPS HDGYCLHGGV CMYIEAVDSY ACNCVFGYVG ERCQHRDLKW with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell...
Schlagworte: EGF
Exprimiert in: E.coli
Ursprungsart: swine
ab 618,00 €
Bewerten
EGF (Epidermal Growth Factor), swine recombinant (rpoEGF)
EGF (Epidermal Growth Factor), swine recombinant (rpoEGF)

Artikelnummer: RP1232S-025

Produced in Yeast. Amino acid sequence: NSYSECPPSH DGYCLHGGVC MYIEAVDSYA CNCVFGYVGE RCQHRDLKWW ELR (53).
Schlagworte: EGF
Anwendung: Bioassays
Exprimiert in: Yeast
Ursprungsart: swine
MW: 6,1 kD
ab 233,00 €
Bewerten
Epidermal Growth Factor (EGF) Recombinant, Porcine
Epidermal Growth Factor (EGF) Recombinant, Porcine

Artikelnummer: 154449.10

Source:, Recombinant Porcine from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q00968, Fragment: Ala45~His275 (Accession No: Q00968), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-APFLIF SHGNSIFRID LEGTNHEQLV ADAGISVLMD FHYNEERIYW VDLERQLLQR...
ab 445,00 €
Bewerten
EGF protein(N-His) (recombinant swine)
EGF protein(N-His) (recombinant swine)

Artikelnummer: E-PKSS000015.100

Sequence:...
Schlagworte: EGF, Recombinant Swine EGF protein(N-His)
Exprimiert in: E.coli
Ursprungsart: swine
MW: 134.35 kD
ab 192,00 €
Bewerten
Porcine EGF (Epidermal growth factor) ELISA Kit
Porcine EGF (Epidermal growth factor) ELISA Kit

Artikelnummer: G-AEFI00792.96

ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 3.125-200µg/mL. Sensitivity: 1.875µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and...
Schlagworte: EGF
Anwendung: Sandwich ELISA, Double Antibody
Spezies-Reaktivität: swine
698,00 €
Bewerten
Swine EGF Recombinant Protein (N-His)
Swine EGF Recombinant Protein (N-His)

Artikelnummer: G-RPES6858.100

Protein function: EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel...
Schlagworte: EGF
Exprimiert in: E.coli
306,00 €
Bewerten