- Suchergebnis für P79073
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P79073" wurden 13 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: TGM-TMPH-03644-10ug
Description: Responsible for spore hydrophobicity and protection. Hydrophobin-2/HFB2 Protein, Trichoderma reesei, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-SUMOSTAR tag. The predicted molecular weight is 23.2 kDa and the accession number is P79073.
| Schlagworte: | hfb2 , Hydrophobin II (HFBII) , Hydrophobin-2 |
| MW: | 23.2 kD |
ab 134,00 €
Artikelnummer: CSB-EP304437HYE.1
Organism: Hypocrea jecorina (Trichoderma reesei). Source: E.coli. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 90% as...
| Schlagworte: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | Hypocrea jecorina (Trichoderma reesei) |
| MW: | 23.2 kD |
ab 364,00 €
Artikelnummer: CSB-EP304437HYEb0.1
Organism: Hypocrea jecorina (Trichoderma reesei). Source: E.coli. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 90% as...
| Schlagworte: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | Hypocrea jecorina (Trichoderma reesei) |
| MW: | 10.7 kD |
ab 364,00 €
Artikelnummer: CSB-EP304437HYEb8.1
Organism: Hypocrea jecorina (Trichoderma reesei). Source: E.coli. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-B2M-JD-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 85% as...
| Schlagworte: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | Hypocrea jecorina (Trichoderma reesei) |
| MW: | 12.7 kD |
ab 364,00 €
Artikelnummer: CSB-YP304437HYE.1
Organism: Hypocrea jecorina (Trichoderma reesei). Source: Yeast. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 85% as...
| Schlagworte: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2) |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | Hypocrea jecorina (Trichoderma reesei) |
| MW: | 9.2 kD |
ab 407,00 €
Artikelnummer: CSB-YP304437HYEa4.1
Organism: Hypocrea jecorina (Trichoderma reesei). Source: Yeast. Expression Region: 16-86aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-sumostar-tagged. Target Protein Sequence: AVCPTGLFSN PLCCATNVLD LIGVDCKTPT IAVDTGAIFQ AHCASKGSKP LCCVAPVADQ ALLCQKAIGT F. Purity: Greater than 90% as...
| Schlagworte: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II, Recombinant Trichoderma reesei Hydrophobin-2 (hfb2) |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | Hypocrea jecorina (Trichoderma reesei) |
| MW: | 23.2 kD |
ab 407,00 €
Artikelnummer: TGM-TMPH-02338-100ug
Description: Responsible for spore hydrophobicity and protection. HFBII Protein, Hypocrea jecorina, Recombinant (B2M & His & JD) is expressed in E. coli expression system with N-10xHis-B2M-JD tag. The predicted molecular weight is 12.7 kDa and the accession number is P79073.
| Schlagworte: | hfb2, Hydrophobin-2, Hydrophobin II |
| MW: | 12.7 kD |
ab 340,00 €
Artikelnummer: TGM-TMPH-03644-100ug
Description: Responsible for spore hydrophobicity and protection. Hydrophobin-2/HFB2 Protein, Trichoderma reesei, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-SUMOSTAR tag. The predicted molecular weight is 23.2 kDa and the accession number is P79073.
| Schlagworte: | Hydrophobin II, hfb2, Hydrophobin-2 |
| MW: | 23.2 kD |
ab 375,00 €
Artikelnummer: TGM-TMPH-02338-10ug
Description: Responsible for spore hydrophobicity and protection. HFBII Protein, Hypocrea jecorina, Recombinant (B2M & His & JD) is expressed in E. coli expression system with N-10xHis-B2M-JD tag. The predicted molecular weight is 12.7 kDa and the accession number is P79073.
| Schlagworte: | Hydrophobin-2 , Hydrophobin II (HFBII) , hfb2 |
| MW: | 12.7 kD |
ab 122,00 €
Artikelnummer: 405951.100
Responsible for spore hydrophobicity and protection. Source: Recombinant protein corresponding to aa16-86 from trichoderma reesei Hydrophobin-2, fused to His-SUMOSTAR-tag at N-terminal, expressed in yeast. Molecular Weight: ~23.2kD, AA Sequence:...
| Schlagworte: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II |
| MW: | 23,2 |
ab 707,00 €
Artikelnummer: 373624.100
Responsible for spore hydrophobicity and protection. Source: Recombinant protein corresponding to aa16-86 from hypocrea jecorina hfb2, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~23.2kD, AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF, Storage...
| Schlagworte: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II |
| MW: | 23,2 |
ab 786,00 €
Artikelnummer: 405950.20
Responsible for spore hydrophobicity and protection. Source: Recombinant protein corresponding to aa16-86 from hypocrea jecorina Hydrophobin-2, fused to His-B2M-JD-tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.7D, AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF,...
| Schlagworte: | hfb2, HFBII, Hydrophobin-2, Hydrophobin II |
| MW: | 12,7 |
ab 786,00 €