Zu "P56386" wurden 6 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Mouse DEFb1 (Defensin Beta 1) ELISA Kit
Artikelnummer: ELK-ELK2248.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse DEFb1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse DEFb1. Next,...
| Schlagworte: | BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
ab 365,00 €
Beta Defensin-1, mouse recombinant (rHuBD-1)
Artikelnummer: 97410.1
Mouse recombinant BD 1 produced in E.coli is a single, non-glycosylated, polypeptide chain containing 37 amino acids and having a molecular mass of 4.1 kDa. The Defensin family are highly similar in their protein sequence and are microbicidal and cytotoxic peptides made by neutrophils. Beta Defensin-1 is an...
| Schlagworte: | Beta-defensin 1, BD-1, Defensin beta 1, hBD-1, HBD1, HBP1, DEFB1, HBD-1, HBP-1, DEFB101, DEFB-1, MGC51822. |
| Anwendung: | Cell Culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 4100 D |
ab 94,00 €
Mouse BD-1 / beta Defensin 1 ELISA Kit
Artikelnummer: G-MOFI00227.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
694,00 €
Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse)
Artikelnummer: 024598.96
Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of DEFb1 in mouse serum, plasma and other biological fluids. Detection Range: 0.78-50ng/ml, Sensitivity: 0.28ng/ml, Storage and Stability: Desiccation recommended. The Standard, Detection...
| Schlagworte: | BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
987,00 €
Defensin Beta 1 (DEFb1) Recombinant, Mouse
Artikelnummer: 154319.10
Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P56386, Fragment: Val22~Ser69 (Accession No: P56386), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-VGILTSLGR RTDQYKCLQH GGFCLRSSCP SNTKLQGTCK PDKPNCCKS, Epitope Tag:...
ab 381,00 €
Beta-defensin 1, Recombinant, Mouse, aa33-69,...
Artikelnummer: 372437.100
Has bactericidal activity. Source: Recombinant protein corresponding to aa33-69 from mouse Defb1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.1kD, AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid...
| Schlagworte: | BD-1, mBD-1, Defb1, Beta-defensin 1, Defensin, beta 1 |
| MW: | 20,1 |
ab 636,00 €