Zu "P56386" wurden 12 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Beta Defensin-1, mouse recombinant (rHuBD-1)
Artikelnummer: 97410.1
Mouse recombinant BD 1 produced in E.coli is a single, non-glycosylated, polypeptide chain containing 37 amino acids and having a molecular mass of 4.1 kDa. The Defensin family are highly similar in their protein sequence and are microbicidal and cytotoxic peptides made by neutrophils. Beta Defensin-1 is an...
| Schlagworte: | Beta-defensin 1, BD-1, Defensin beta 1, hBD-1, HBD1, HBP1, DEFB1, HBD-1, HBP-1, DEFB101, DEFB-1, MGC51822. |
| Anwendung: | Cell Culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 4100 D |
ab 105,00 €
Mouse BD-1 / beta Defensin 1 ELISA Kit
Artikelnummer: G-MOFI00227.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
698,00 €
Beta-defensin 1 (Defb1), mouse, recombinant
Artikelnummer: CSB-EP006662MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 33-69aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: DQYKCLQHGG FCLRSSCPSN TKLQGTCKPD KPNCCKS. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological...
| Schlagworte: | BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1, Recombinant Mouse Beta-defensin 1 (Defb1) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 20.1 kD |
ab 364,00 €
Beta Defensin 1/DEFB1 Protein, Mouse, Recombinant (His &...
Artikelnummer: TGM-TMPH-02541-100ug
Description: Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
| Schlagworte: | Defb1, Defensin, beta 1, Beta-defensin 1, mBD-1, BD-1 |
| MW: | 20.1 kD |
ab 340,00 €
DEFB1 Protein, Mouse, Recombinant (His & SUMO)
Artikelnummer: TGM-TMPH-02541-10ug
Description: Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
| Schlagworte: | Defensin, beta 1 , mBD-1 , Beta-defensin 1 , BD-1 , Defb1 |
| MW: | 20.1 kD |
ab 122,00 €
Mouse DEFb1 (Defensin Beta 1) ELISA Kit
Artikelnummer: G-AEKE04319.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse DEFb1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse DEFb1. Next,...
| Schlagworte: | Defb1, Beta-defensin 1, Defensin, beta 1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
694,00 €
Mouse beta-defensins 1 ELISA Kit
Artikelnummer: CSB-E14188m.48
Sample Types: serum, plasma, cell culture supernates, tissue homogenates Detection Range: 15.6 pg/mL-1000 pg/mL Sensitivity: 3.9 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Has bactericidal activity. May act as a...
| Schlagworte: | BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1 |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | mouse |
ab 658,00 €
Mouse DEFb1(Defensin Beta 1) ELISA Kit
Artikelnummer: ELK-ELK10385.48
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility Assay Type: Sandwich. Sensitivity: 12.7 pg/mL....
| Schlagworte: | Defb1, Beta-defensin 1, Defensin, beta 1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
ab 374,00 €
Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse)
Artikelnummer: 024598.96
Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of DEFb1 in mouse serum, plasma and other biological fluids. Detection Range: 0.78-50ng/ml, Sensitivity: 0.28ng/ml, Storage and Stability: Desiccation recommended. The Standard, Detection...
| Schlagworte: | BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.113,00 €
Defensin Beta 1 (DEFb1) Recombinant, Mouse
Artikelnummer: 154319.10
Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P56386, Fragment: Val22~Ser69 (Accession No: P56386), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-VGILTSLGR RTDQYKCLQH GGFCLRSSCP SNTKLQGTCK PDKPNCCKS, Epitope Tag:...
ab 400,00 €
Beta-defensin 1, Recombinant, Mouse, aa33-69,...
Artikelnummer: 372437.100
Has bactericidal activity. Source: Recombinant protein corresponding to aa33-69 from mouse Defb1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.1kD, AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid...
| Schlagworte: | BD-1, mBD-1, Defb1, Beta-defensin 1, Defensin, beta 1 |
| MW: | 20,1 |
ab 786,00 €
Anti-Defb1
Artikelnummer: CSB-PA006662ZA01MO.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-BD-1, Anti-Defb1, Anti-mBD-1, Anti-Beta-defensin 1, Anti-Defensin, beta 1, Defb1 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Mus musculus (Mouse) |
ab 1.529,00 €