- Suchergebnis für P56202
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P56202" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: TGM-TMPH-03836-100ug
Description: Cathepsin W Protein, Human, Recombinant (His & Myc) is expressed in E. coli with N-10xHis, C-Myc. The accession number is P56202.
| Schlagworte: | Cathepsin W , CTSW , Lymphopain |
| MW: | 33.1 kD |
ab 122,00 €
Artikelnummer: CSB-EP006205HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 128-376aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: VPFSCDWRKV ASAISPIKDQ KNCNCCWAMA AAGNIETLWR ISFWDFVDVS VQELLDCGRC GDGCHGGFVW DAFITVLNNS GLASEKDYPF QGKVRAHRCH PKKYQKVAWI...
| Schlagworte: | CTSW, Lymphopain, EC=3.4.22.-, Cathepsin W, Recombinant Human Cathepsin W (CTSW) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 33.1 kD |
ab 364,00 €
Artikelnummer: ATA-HPA066903.100
Polyclonal Antibody against Human CTSW, Gene description: cathepsin W, Validated applications: IHC, Uniprot ID: P56202, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity....
| Schlagworte: | Anti-CTSW, Anti-Lymphopain, Anti-Cathepsin W, EC=3.4.22.- |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-11900-L.100
Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity. [The UniProt Consortium]
| Schlagworte: | Cathepsin W, Lymphopain, Recombinant Human CTSW Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 40.5 kD |
ab 115,00 €
Artikelnummer: VHPS-2334
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | CTSW, Lymphopain, Cathepsin W, EC=3.4.22.- |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: ELK-ES19963.100
Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000 ELISA 1:5000-20000. Cellular localization: Endoplasmic reticulum .
| Schlagworte: | Anti-cleaved-CTSW, Anti-cleaved-Lymphopain, Anti-cleaved-Cathepsin W, EC=3.4.22.-, CATW (Cleaved-Val128) rabbit pAb |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
Artikelnummer: CSB-CL006205HU.10
Length: 1131 Sequence: atggcactga ctgcccaccc ctcctgcctc ctggccctgt tggtggcagg cctagcccaa ggcatcagag gcccccttag ggcccaggac ctaggtcccc agccgctaga gctgaaagag gccttcaagt tgttccagat ccagttcaac cggagttacc tgagcccaga agagcatgct caccgcctgg acatctttgc ccacaacctg gcccaggctc agaggctgca ggaggaggac ttgggcacag ctgagtttgg...
| Schlagworte: | CTSW, Lymphopain, EC=3.4.22.-, Cathepsin W |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
421,00 €
Artikelnummer: ABS-PP-11900.100
Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity. [The UniProt Consortium]
| Schlagworte: | Cathepsin W, Lymphopain, Recombinant Human CTSW Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 40.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95971.100
PrEST Antigen CTSW, Gene description: cathepsin W, Antigen sequence: EEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May have a specific function in the mechanism or regulation of T-cell...
| Schlagworte: | CTSW, Lymphopain, Cathepsin W, EC=3.4.22.- |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €