- Suchergebnis für P55213
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P55213" wurden 13 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ELK-ELK1528.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat CASP3. Next,...
| Schlagworte: | Cpp32, Casp3, EC=3.4.22.56 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 374,00 €
Artikelnummer: G-AEKE05846.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat CASP3. Next,...
| Schlagworte: | IRP, LICE, Casp3, Apopain, Caspase-3, Protein Yama, Cysteine protease CPP32, SREBP cleavage activity 1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
694,00 €
Artikelnummer: G-AEKE05847.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat CASP3. Next,...
| Schlagworte: | IRP, LICE, Casp3, Apopain, Caspase-3, Protein Yama, Cysteine protease CPP32, SREBP cleavage activity 1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
694,00 €
Artikelnummer: CSB-E08857r.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 0.312 ng/mL-20 ng/mL Sensitivity: 0.078 ng/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Involved in the activation cascade of caspases responsible for...
| Schlagworte: | Cpp32, Casp3, EC=3.4.22.56 |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | rat |
ab 517,00 €
Artikelnummer: E-EL-R0160.24
The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of CASP3 in serum, plasma and other biological fluids. Detection Range: 0.31--20ng/mL. Sensitivity: 0.19ng/mL. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis...
| Schlagworte: | Casp3, Cpp32, EC=3.4.22.56 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 122,00 €
Artikelnummer: 517075.96
Sample Type:, Serum, plasma, tissue homogenates, cell lysates and other biological fluids, Intended Use: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of CASP3 in rat serum, plasma, tissue homogenates, cell lysates and other biological fluids. Sensitivity: 5.3pg/ml, Range:...
| Schlagworte: | Casp3, Cpp32, EC=3.4.22.56 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
1.173,00 €
Artikelnummer: VRPS-812
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | IRP, LICE, Casp3, Cpp32, SCA-1, CPP-32, CASP-3, Apopain, Caspase-3, EC=3.4.22.56, Protein Yama, Caspase-3 subunit p12,... |
| Anwendung: | RNA quantification |
54,00 €
Artikelnummer: 153876.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P55213, Fragment: Ser29~Asp175 (Accession No: P55213), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SG IYLDSSYKMD YPEMGLCIII NNKNFHKSTGMSARNGTDVD AANLRETFMA LKYEVRNKND LTREEIMELM DSVSKEDHSK...
ab 520,00 €
Artikelnummer: 153877.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P55213, Fragment: Ala183~His277 (Accession No: P55213), Sequence: MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGS- ACQKIPVE ADFLYAYSTA PGYYSWRNSR DGSWFIQSLC AMLKLYAHKL EFMHILTRVN RKVATEFESF SLDATFHAKK...
ab 477,00 €
Artikelnummer: G-RTFI00082.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
698,00 €
Artikelnummer: G-AEES00344.96
ELISA Type: Sandwich. Detection Range: 0.31-20µg/mL. Sensitivity: 0.19µg/mL. Sample Types: Serum, plasma and other biological fluids. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis, it proteolytically cleaves poly(ADP-ribose) polymerase...
| Schlagworte: | Casp3, Cpp32, EC=3.4.22.56 |
| Anwendung: | Sandwich |
| Spezies-Reaktivität: | rat |
708,00 €
Artikelnummer: E-PDER100193.1
Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis, it proteolytically cleaves poly(ADP-ribose) polymerase PARP1 at a '216-Asp-, -Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix...
| Schlagworte: | IRP, LICE, Casp3, Apopain, Caspase-3, Protein Yama, Cysteine protease CPP32, SREBP cleavage activity 1, Recombinant Rat... |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
ab 192,00 €