Zu "P55213" wurden 13 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Rat CASP3 (Caspase 3) ELISA Kit
Rat CASP3 (Caspase 3) ELISA Kit

Artikelnummer: ELK-ELK1528.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat CASP3. Next,...
Schlagworte: Cpp32, Casp3, EC=3.4.22.56
Anwendung: ELISA
Spezies-Reaktivität: rat
ab 374,00 €
Bewerten
Rat CASP3 (Caspase 3) ELISA Kit
Rat CASP3 (Caspase 3) ELISA Kit

Artikelnummer: G-AEKE05846.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat CASP3. Next,...
Schlagworte: IRP, LICE, Casp3, Apopain, Caspase-3, Protein Yama, Cysteine protease CPP32, SREBP cleavage activity 1
Anwendung: ELISA
Spezies-Reaktivität: rat
694,00 €
Bewerten
Rat CASP3 (Caspase 3) ELISA (Small Sample Volume)
Rat CASP3 (Caspase 3) ELISA (Small Sample Volume)

Artikelnummer: G-AEKE05847.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat CASP3. Next,...
Schlagworte: IRP, LICE, Casp3, Apopain, Caspase-3, Protein Yama, Cysteine protease CPP32, SREBP cleavage activity 1
Anwendung: ELISA
Spezies-Reaktivität: rat
694,00 €
Bewerten
Rat Caspase 3, Casp-3 ELISA Kit
Rat Caspase 3, Casp-3 ELISA Kit

Artikelnummer: CSB-E08857r.48

Sample Types: serum, plasma, tissue homogenates Detection Range: 0.312 ng/mL-20 ng/mL Sensitivity: 0.078 ng/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Involved in the activation cascade of caspases responsible for...
Schlagworte: Cpp32, Casp3, EC=3.4.22.56
Anwendung: ELISA, Sandwich ELISA
Spezies-Reaktivität: rat
ab 517,00 €
Bewerten
-10 %
Rabattaktion
Rat CASP3 (Caspase 3) ELISA Kit
Rat CASP3 (Caspase 3) ELISA Kit

Artikelnummer: E-EL-R0160.24

The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of CASP3 in serum, plasma and other biological fluids. Detection Range: 0.31--20ng/mL. Sensitivity: 0.19ng/mL. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis...
Schlagworte: Casp3, Cpp32, EC=3.4.22.56
Anwendung: ELISA
Spezies-Reaktivität: rat
122,00 € ab 109,80 €
Bewerten
Caspase 3 (CASP3) High Sensitivity BioAssay(TM) ELISA Kit (Rat)
Caspase 3 (CASP3) High Sensitivity BioAssay(TM) ELISA Kit...

Artikelnummer: 517075.96

Sample Type:, Serum, plasma, tissue homogenates, cell lysates and other biological fluids, Intended Use: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of CASP3 in rat serum, plasma, tissue homogenates, cell lysates and other biological fluids. Sensitivity: 5.3pg/ml, Range:...
Schlagworte: Casp3, Cpp32, EC=3.4.22.56
Anwendung: ELISA
Spezies-Reaktivität: rat
1.173,00 €
Bewerten
Caspase3 (Rat), His-Tag Recombinant
Caspase3 (Rat), His-Tag Recombinant

Artikelnummer: BPS-102292-1

Rat recombinant caspase3 protease, full length encompassing amino acids 1-277 (end). This construct contains a C-terminal His-tag (6xHis). The protein was affinity purified.
Schlagworte: Cpp32, Casp3, EC=3.4.22.56, Caspase3 (Rat) (1-277(end)-His)
Anwendung: Enzyme kinetics, inhibitor screening, selectivity profiling
Exprimiert in: E.coli
Ursprungsart: rat
MW: 13/17 kD
ab 189,00 €
Bewerten
Casp3, Rat caspase 3, apoptosis related cysteine protease, Real Time PCR Primer Set
Casp3, Rat caspase 3, apoptosis related cysteine...

Artikelnummer: VRPS-812

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: IRP, LICE, Casp3, Cpp32, SCA-1, CPP-32, CASP-3, Apopain, Caspase-3, EC=3.4.22.56, Protein Yama, Caspase-3 subunit p12,...
Anwendung: RNA quantification
54,00 €
Bewerten
Caspase 3 (CASP3) Recombinant, Rat
Caspase 3 (CASP3) Recombinant, Rat

Artikelnummer: 153876.10

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P55213, Fragment: Ser29~Asp175 (Accession No: P55213), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SG IYLDSSYKMD YPEMGLCIII NNKNFHKSTGMSARNGTDVD AANLRETFMA LKYEVRNKND LTREEIMELM DSVSKEDHSK...
ab 520,00 €
Bewerten
Caspase 3 (CASP3) Recombinant, Rat
Caspase 3 (CASP3) Recombinant, Rat

Artikelnummer: 153877.10

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P55213, Fragment: Ala183~His277 (Accession No: P55213), Sequence: MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGS- ACQKIPVE ADFLYAYSTA PGYYSWRNSR DGSWFIQSLC AMLKLYAHKL EFMHILTRVN RKVATEFESF SLDATFHAKK...
ab 477,00 €
Bewerten
Rat Caspase 3 ELISA Kit
Rat Caspase 3 ELISA Kit

Artikelnummer: G-RTFI00082.96

Anwendung: ELISA
Spezies-Reaktivität: rat
698,00 €
Bewerten
Rat CASP3 (Caspase 3) ELISA Kit
Rat CASP3 (Caspase 3) ELISA Kit

Artikelnummer: G-AEES00344.96

ELISA Type: Sandwich. Detection Range: 0.31-20µg/mL. Sensitivity: 0.19µg/mL. Sample Types: Serum, plasma and other biological fluids. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis, it proteolytically cleaves poly(ADP-ribose) polymerase...
Schlagworte: Casp3, Cpp32, EC=3.4.22.56
Anwendung: Sandwich
Spezies-Reaktivität: rat
708,00 €
Bewerten
1 von 2 Seiten