Zu "P55213" wurden 13 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Rat CASP3 (Caspase 3) ELISA Kit
Artikelnummer: ELK-ELK1528.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat CASP3. Next,...
| Schlagworte: | Cpp32, Casp3, EC=3.4.22.56 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 365,00 €
Rat CASP3 (Caspase 3) ELISA Kit
Artikelnummer: E-EL-R0160.96
The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of CASP3 in serum, plasma and other biological fluids. Detection Range: 0.31--20ng/mL. Sensitivity: 0.19ng/mL. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis...
| Schlagworte: | Casp3, Cpp32, EC=3.4.22.56 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
483,00 €
Rat CASP3 (Caspase 3) CLIA Kit
Artikelnummer: E-CL-R0117.96
Type: Sandwich. Detection Range: 62.5~4000pg/mL. Sensitivity: 37.5pg/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3 . Standards or samples...
| Schlagworte: | Casp3, Cpp32, EC=3.4.22.56 |
| Anwendung: | CLIA |
| Spezies-Reaktivität: | rat |
541,00 €
CASP3 protein (His tag), recombinant rat
Artikelnummer: E-PDER100049.100
Activity: Testing in progress Protein Construction: A DNA sequence encoding the Rat CASP3 protein (P55213) (Ser 29-Asp 175) was expressed with a N-His tag. Sequence: Ser 29-Asp 175. Fusion tag: N-His Endotoxin: Please contact us for more information. Apparent Molecular Mass: 20 kDa. Protein function: Involved in the...
| Schlagworte: | Casp3, Cpp32, EC=3.4.22.56, Recombinant Rat CASP3 protein (His tag) |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
| MW: | 16.06 kD |
ab 81,00 €
Rat CASP3 (Caspase 3) CLIA Kit
Artikelnummer: E-CL-R0117.24
Type: Sandwich. Detection Range: 62.5~4000pg/mL. Sensitivity: 37.5pg/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat CASP3 . Standards or samples...
| Schlagworte: | Casp3, Cpp32, EC=3.4.22.56 |
| Anwendung: | CLIA |
| Spezies-Reaktivität: | rat |
ab 142,00 €
Rat CASP3 (Caspase 3) ELISA Kit
Artikelnummer: E-EL-R0160.24
The kit is a Sandwich enzyme immunoassay for in vitro quantitative measurement of CASP3 in serum, plasma and other biological fluids. Detection Range: 0.31--20ng/mL. Sensitivity: 0.19ng/mL. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis...
| Schlagworte: | Casp3, Cpp32, EC=3.4.22.56 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 118,00 €
Casp3, Rat caspase 3, apoptosis related cysteine...
Artikelnummer: VRPS-812
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | IRP, LICE, Casp3, Cpp32, SCA-1, CPP-32, CASP-3, Apopain, Caspase-3, EC=3.4.22.56, Protein Yama, Caspase-3 subunit p12,... |
| Anwendung: | RNA quantification |
52,00 €
Caspase 3 (CASP3) Recombinant, Rat
Artikelnummer: 153876.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P55213, Fragment: Ser29~Asp175 (Accession No: P55213), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SG IYLDSSYKMD YPEMGLCIII NNKNFHKSTGMSARNGTDVD AANLRETFMA LKYEVRNKND LTREEIMELM DSVSKEDHSK...
ab 419,00 €
Caspase 3 (CASP3) Recombinant, Rat
Artikelnummer: 153877.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P55213, Fragment: Ala183~His277 (Accession No: P55213), Sequence: MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGS- ACQKIPVE ADFLYAYSTA PGYYSWRNSR DGSWFIQSLC AMLKLYAHKL EFMHILTRVN RKVATEFESF SLDATFHAKK...
ab 419,00 €
CASP3 (Caspase 3) BioAssay(TM) ELISA Kit (Rat)
Artikelnummer: 382192.96
Sample Type:, Serum, Plasma, Biological Fluids, Intended Use: This BioAssay(TM) kit is a sandwich ELISA for in vitro quantitative measurement of CASP3 in rat serum, plasma and other biological fluids, Sensitivity: 0.188ng/mL, Range: 0.313-20ng/mL, Specificity: Rat, Test Principle: This BioAssay(TM) ELISA kit uses...
| Schlagworte: | Casp3, Cpp32, EC=3.4.22.56 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
894,00 €
Caspase 3 (CASP3) High Sensitivity BioAssay(TM) ELISA Kit...
Artikelnummer: 517075.96
Sample Type:, Serum, plasma, tissue homogenates, cell lysates and other biological fluids, Intended Use: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of CASP3 in rat serum, plasma, tissue homogenates, cell lysates and other biological fluids. Sensitivity: 5.3pg/ml, Range:...
| Schlagworte: | Casp3, Cpp32, EC=3.4.22.56 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
1.043,00 €
Rat CASP3 (Caspase 3) CLIA Kit
Artikelnummer: G-RTES00096.96
ELISA Type: CLIA. Sensitivity: 37.5 pg/mL. Range: 62.5--4000 pg/mL. Protein function: Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-, -Gly-217' bond. Cleaves and activates...
| Schlagworte: | Casp3, Cpp32, EC=3.4.22.56 |
| Anwendung: | CLIA |
| Spezies-Reaktivität: | rat |
694,00 €