- Suchergebnis für P55201
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P55201" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: BPS-31112
Human Bromodomain and PHD finger containing 1, or BRPF1, amino-acids 627 ? 746 (GenBank Accession No. NM_001003694) with N-terminal HIS-tag, MW = 15.1 kDa, expressed in an E. coli expression system.
Schlagworte: | Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1, |
Anwendung: | BRD binding assays, inhibitor screening, selectivity profiling |
Exprimiert in: | E.coli |
Ursprungsart: | human |
MW: | 14.3 kD |
452,00 €
Artikelnummer: G-CAB17012.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Schlagworte: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1, BRPF1 Rabbit pAb |
Anwendung: | WB, IF |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 352,00 €
Artikelnummer: ATA-HPA003359.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Schlagworte: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1 |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 335,00 €
Artikelnummer: E-AB-91679.120
This gene encodes a bromodomain, PHD finger and chromo/Tudor-related Pro-Trp-Trp-Pro (PWWP) domain containing protein. The encoded protein is a component of the MOZ/MORF histone acetyltransferase complexes which function as a transcriptional regulators. This protein binds to the catalytic MYST domains of the MOZ and...
Schlagworte: | Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1, BRPF1 Polyclonal Antibody |
Anwendung: | WB, IF |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 198,00 €
Artikelnummer: ELK-ES18906.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Schlagworte: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1, BRPF1 rabbit pAb |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, rat, mouse, |
ab 169,00 €
Artikelnummer: B2852-48.50
The protein encoded by this gene is expressed ubiquitously and at the highest level in testes and spermatogonia. The protein is localized within nuclei, and it is very similar in structure to two zinc finger proteins, AF10 and AF17. It is suggested that these proteins form a family of regulatory proteins. Two...
Schlagworte: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1 |
Anwendung: | ELISA, FC, IP, WB |
Wirt: | Mouse |
Spezies-Reaktivität: | human, mouse |
531,00 €
Artikelnummer: 298382.100
Source:, Recombinant protein corresponding to aa2054-2168 from human Bromodomain and PHD finger containing 1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.1kD, AA Sequence: MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPL, SEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDF,...
Schlagworte: | Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1 |
MW: | 15,1 |
916,00 €
Artikelnummer: ATA-APrEST84803.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Schlagworte: | Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1 |
Anwendung: | Control antigen |
Exprimiert in: | E.coli |
Ursprungsart: | human |
247,00 €
Artikelnummer: G-CAB17012.20
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Schlagworte: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1 |
Anwendung: | WB, IF |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
149,00 €