Zu "P55201" wurden 9 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
BRPF1 (627-746), human recombinant protein, N-terminal...
Artikelnummer: BPS-31112
Human Bromodomain and PHD finger containing 1, or BRPF1, amino-acids 627 ? 746 (GenBank Accession No. NM_001003694) with N-terminal HIS-tag, MW = 15.1 kDa, expressed in an E. coli expression system.
| Schlagworte: | Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1, |
| Anwendung: | BRD binding assays, inhibitor screening, selectivity profiling |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 14.3 kD |
452,00 €
Anti-BRPF1
Artikelnummer: G-CAB17012.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
| Schlagworte: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1, BRPF1 Rabbit pAb |
| Anwendung: | WB, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 352,00 €
Anti-BRPF1
Artikelnummer: ATA-HPA003359.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
| Schlagworte: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 335,00 €
Anti-BRPF1
Artikelnummer: E-AB-91679.120
This gene encodes a bromodomain, PHD finger and chromo/Tudor-related Pro-Trp-Trp-Pro (PWWP) domain containing protein. The encoded protein is a component of the MOZ/MORF histone acetyltransferase complexes which function as a transcriptional regulators. This protein binds to the catalytic MYST domains of the MOZ and...
| Schlagworte: | Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1, BRPF1 Polyclonal Antibody |
| Anwendung: | WB, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 198,00 €
Anti-BRPF1
Artikelnummer: ELK-ES18906.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
| Schlagworte: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1, BRPF1 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 169,00 €
Anti-Bromodomain and PHD Finger Containing 1 (BRPF1, BR1
Artikelnummer: B2852-48.50
The protein encoded by this gene is expressed ubiquitously and at the highest level in testes and spermatogonia. The protein is localized within nuclei, and it is very similar in structure to two zinc finger proteins, AF10 and AF17. It is suggested that these proteins form a family of regulatory proteins. Two...
| Schlagworte: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1 |
| Anwendung: | ELISA, FC, IP, WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human, mouse |
531,00 €
BRPF1, Recombinant, Human, aa2054-2168, His-Tag...
Artikelnummer: 298382.100
Source:, Recombinant protein corresponding to aa2054-2168 from human Bromodomain and PHD finger containing 1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.1kD, AA Sequence: MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPL, SEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDF,...
| Schlagworte: | Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1 |
| MW: | 15,1 |
916,00 €
BRPF1 PrEST Antigen
Artikelnummer: ATA-APrEST84803.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
| Schlagworte: | Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
247,00 €
Anti-BRPF1
Artikelnummer: G-CAB17012.20
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
| Schlagworte: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1 |
| Anwendung: | WB, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
149,00 €