Zu "P48199" wurden 16 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
+ Gratis T-Shirt
Rat CRP (C-Reactive Protein) CLIA Kit
Rat CRP (C-Reactive Protein) CLIA Kit

Artikelnummer: G-RTES00018.96

ELISA Type: CLIA. Sensitivity: 0.094 ng/mL. Range: 0.156--10 ng/mL. Protein function: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA...
Schlagworte: Crp, Ptx1, C-reactive protein
Anwendung: CLIA
Reaktivität: Rat
681,00 €
C-reactive Protein (CRP), BioAssay(TM) ELISA Kit (Rat)
C-reactive Protein (CRP), BioAssay(TM) ELISA Kit (Rat)

Artikelnummer: 350977.96

C-reactive protein (CRP) is an annular, pentameric protein found in the blood plasma, the levels of which rise in response to inflammation. Its physiological role is to bind to lysophosphatidyl- choline expressed on the surface of dead or dying cells (and some types of bacteria) in order to activate the complement...
Schlagworte: Crp, Ptx1, C-reactive protein
Anwendung: ELISA
Reaktivität: Rat
714,00 €
CRP (C-Reactive Protein) BioAssay(TM) ELISA Kit (Rat)
CRP (C-Reactive Protein) BioAssay(TM) ELISA Kit (Rat)

Artikelnummer: 382498.96

Sample Type:, Serum, Plasma, Biological Fluids, Intended Use: This BioAssay(TM) kit is a sandwich ELISA for in vitro quantitative measurement of CRP in rat serum, plasma and other biological fluids, Sensitivity: 0.188ng/mL, Range: 0.313-20ng/mL, Specificity: Rat, Test Principle: This BioAssay(TM) ELISA kit uses...
Schlagworte: Crp, Ptx1, C-reactive protein
Anwendung: ELISA
Reaktivität: Rat
587,00 €
+ Gratis T-Shirt

Artikelnummer: KOA0606

Natural and recombinant rat CRP. There is no detectable cross-reactivity with other relevant proteins. Protein function: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to...
Schlagworte: Crp, Ptx1, C-reactive protein
Anwendung: ELISA
Reaktivität: Rat
673,00 €
Recombinant Rat CRP / C-Reactive Protein (His tag)
Recombinant Rat CRP / C-Reactive Protein (His tag)

Artikelnummer: E-PKSR030385.200

Protein function: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from...
Reaktivität: Rat
ab 315,00 €
Anti-C Reactive Protein
Anti-C Reactive Protein

Artikelnummer: ARG40827.50

Protein function: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from...
Schlagworte: Anti-Crp, Anti-Ptx1, Anti-C-reactive protein
Anwendung: IHC (paraffin), WB
Reaktivität: Rat
439,00 €
Rat CRP (C-Reactive Protein) ELISA Kit
Rat CRP (C-Reactive Protein) ELISA Kit

Artikelnummer: E-EL-R3002.96

This ELISA kit uses the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Rat CRP. Standards or samples are added to the micro ELISA plate wells and combined with the specific antibody. Then a biotinylated detection antibody specific for Rat CRP and...
Schlagworte: Crp, Ptx1, C-reactive protein
Anwendung: ELISA
Reaktivität: Rat
455,00 €
-20 %
Rat C Reactive Protein ELISA Kit
Rat C Reactive Protein ELISA Kit

Artikelnummer: ARG81795.96

Protein function: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from...
Schlagworte: Crp, Ptx1, C-reactive protein
Anwendung: ELISA
Reaktivität: Rat
805,00 € 644,00 €
Crp, Rat C-reactive protein, pentraxin-related, Real Time PCR Primer Set
Crp, Rat C-reactive protein, pentraxin-related, Real Time...

Artikelnummer: VRPS-1336

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: Crp, Ptx1, C-reactive protein
Anwendung: RNA quantification
49,00 €
CRP BioAssay(TM) ELISA Kit, Rat
CRP BioAssay(TM) ELISA Kit, Rat

Artikelnummer: 143783.96

Sandwich ELISA quantitative detection kit for Mouse CRP in cell culture supernates, serum and plasma (heparin, EDTA). C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities...
Schlagworte: Crp, Ptx1, C-reactive protein
Anwendung: ELISA
Reaktivität: Rat
704,00 €

Artikelnummer: E-AB-40277.120

C-reactive protein (CRP) is an acute-phase serum protein synthesized by the liver in response to interleukin-6 (IL-6) during inflammation. The name of CRP derives from its ability to react with the C polysaccharide of Streptococcus pneumoniae. CRP is an annular,pentameric protein that belongs to the pentraxin family...
Schlagworte: Anti-Crp, Anti-Ptx1, Anti-C-reactive protein, CRP Polyclonal Antibody
Anwendung: IHC
Reaktivität: Mouse, Rat
ab 55,00 €
C Reactive Protein (CRP) Recombinant, Rat
C Reactive Protein (CRP) Recombinant, Rat

Artikelnummer: 153742.10

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P48199, Fragment: His20~Ser230 (Accession No: P48199), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-H EDMSKQAFVF PGVSATAYVS LEAESKKPLE AFTVCLYAHA DVSRSFSIFS YATKTSFNEI LLFWTRGQGF SIAVGGPEIL...
ab 283,00 €
1 von 2 Seiten