- Suchergebnis für P43027
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P43027" wurden 16 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ELK-ELK6710.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse GDF5. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse GDF5. Next,...
Schlagworte: | Gdf5, GDF-5, Bmp14, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Anwendung: | ELISA |
Spezies-Reaktivität: | mouse |
ab 365,00 €
Artikelnummer: G-MOFI00249.96
Anwendung: | ELISA |
Spezies-Reaktivität: | mouse |
694,00 €
Artikelnummer: G-MOES00317.96
ELISA Type: CLIA. Sensitivity: 18.75 ng/mL. Range: 31.25--2000 ng/mL. Protein function: Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue...
Schlagworte: | Gdf5, Bmp14, GDF-5, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Anwendung: | CLIA |
Spezies-Reaktivität: | mouse |
694,00 €
Artikelnummer: ARG70100.100
Protein function: Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with...
Schlagworte: | Gdf5, GDF-5, Bmp14, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Anwendung: | SDS-PAGE, Cell culture |
Ursprungsart: | human |
ab 336,00 €
Artikelnummer: ARG82352.96
Protein function: Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with...
Schlagworte: | Gdf5, GDF-5, Bmp14, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Anwendung: | ELISA |
Spezies-Reaktivität: | mouse |
1.416,00 €
Artikelnummer: G-PACO26937.50
Gdf5 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse and for use in ELISA, IHC applications. Gdf5 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Growth factor involved in bone and cartilage formation. During cartilage development...
Schlagworte: | Anti-Gdf5, Anti-Bmp14, Anti-GDF-5, Anti-BMP-14, Anti-Bone morphogenetic protein 14, Anti-Growth/differentiation factor 5 |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | mouse |
363,00 €
Artikelnummer: E-CL-M0364.24
Type: Sandwich. Detection Range: 31.25~2000ng/mL. Sensitivity: 18.75ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse GDF5 . Standards or...
Schlagworte: | Gdf5, Bmp14, GDF-5, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Anwendung: | CLIA |
Spezies-Reaktivität: | mouse |
ab 142,00 €
Artikelnummer: VMPS-2408
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | Gdf5, Growth differentiation factor 5 |
Anwendung: | RNA quantification |
43,00 €
Artikelnummer: G8989-45A.500
Growth Differentiation Factor 5 (GDF5) is a member of the bone morphogenetic protein (BMP) subfamily of the TGF-beta superfamily. It is synthesized as a large precursor protein that consists of an N-terminal 19aa signal sequence, a 362aa pro region and a 130aa C-terminal mature peptide (aa376-495). Homodimeric GDF5...
Schlagworte: | Anti-Gdf5, Anti-GDF-5, Anti-Bmp14, Anti-BMP-14, Anti-Bone morphogenetic protein 14, Anti-Growth/differentiation factor 5 |
Anwendung: | ELISA, Neutr. |
Wirt: | Rat |
Spezies-Reaktivität: | mouse |
1.189,00 €
Artikelnummer: 025491.96
Growth Differentiation Factor 5 (GDF5) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of GDF5 in mouse serum, plasma, tissue homogenates and other biological fluids. Detection Range: 0.156-10ng/ml, Sensitivity: 0.065ng/m, Storage and Stability: Desiccation...
Schlagworte: | Gdf5, Bmp14, GDF-5, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Anwendung: | ELISA |
Spezies-Reaktivität: | mouse |
1.016,00 €
Artikelnummer: 154921.10
Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P43027, Fragment: Gln358~Arg495 (Accession No: P43027), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-QDD KTVYEYLFSQ RRKRRAPLAN RQGKRPSKNL KARCSRKALH VNFKDMGWDD WIIAPLEYEA...
ab 387,00 €
Artikelnummer: E-CL-M0364.96
Type: Sandwich. Detection Range: 31.25~2000ng/mL. Sensitivity: 18.75ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse GDF5 . Standards or...
Schlagworte: | Gdf5, Bmp14, GDF-5, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Anwendung: | CLIA |
Spezies-Reaktivität: | mouse |
541,00 €