- Suchergebnis für P42677
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P42677" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ARG63311.100
Schlagworte: | Anti-MPS1, Anti-RPS27, Anti-MPS-1, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27 |
Anwendung: | ELISA, WB |
Wirt: | Goat |
Spezies-Reaktivität: | human |
784,00 €
Artikelnummer: NSJ-R35054-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Metallopanstimulin 1, RPS27, Ribosomal protein S27, RPS27
Schlagworte: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, MPS1 Antibody |
Anwendung: | WB, ELISA (peptide), IHC (paraffin) |
Wirt: | Goat |
Spezies-Reaktivität: | human |
755,00 €
Artikelnummer: G-CAB6729.100
Anwendung: | IHC, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 352,00 €
Artikelnummer: 030453.100
MPS1, also known as RPS27. It is a ribosomal protein. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. MPS1 is a component of the 40S subunit....
Schlagworte: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27 |
Anwendung: | ELISA, IHC |
Wirt: | Mouse |
Spezies-Reaktivität: | human |
682,00 €
Artikelnummer: 030454.100
MPS1, also known as RPS27. It is a ribosomal protein. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. MPS1 is a component of the 40S subunit....
Schlagworte: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27 |
Anwendung: | ELISA |
Wirt: | Mouse |
Spezies-Reaktivität: | human |
682,00 €
Artikelnummer: 225626.100
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 516,00 €
Artikelnummer: NSJ-R32561
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 40S ribosomal protein S27, also known as Metallopan-stimulin 1 or MPS-1, is a protein that in humans is encoded by the RPS27 gene. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these...
Schlagworte: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
Anwendung: | WB, IHC (paraffin), IF, ICC, FC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
755,00 €
Artikelnummer: 375142.100
Source:, Recombinant protein corresponding to aa1-84 from human RPS27, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.3kD, AA Sequence: PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH, Storage and Stability: May be stored at 4°C for short-term only....
Schlagworte: | MPS1, MPS-1, RPS27, Metallopan-stimulin 1, 40S ribosomal protein S27, Small ribosomal subunit protein eS27 |
MW: | 36,3 |
ab 575,00 €
Artikelnummer: G-CAB6729.20
Protein function: Component of the small ribosomal subunit (PubMed:8706699). Required for proper rRNA processing and maturation of 18S rRNAs (PubMed:25424902). [The UniProt Consortium]
Schlagworte: | Anti-MPS1, Anti-RPS27, Anti-MPS-1, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, rat |
149,00 €