Zu "P30408" wurden 12 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-TM4SF1 (AGX101 Biosimilar Antibody)
Artikelnummer: G-HDBS0139.100
| Schlagworte: | Anti-M3S1, Anti-TM4SF1, Anti-Tumor-associated antigen L6, Anti-Transmembrane 4 L6 family member 1, Anti-Membrane component... |
| Anwendung: | FC |
| Wirt: | Human |
| Spezies-Reaktivität: | human |
399,00 €
Anti-TMEM16A
Artikelnummer: 600-401-FH6
Anti-TMEM16A Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with TMEM16A from other sources has not been determined.
| Schlagworte: | Anti-M3S1, Anti-TM4SF1, Anti-Tumor-associated antigen L6, Anti-Transmembrane 4 L6 family member 1, Anti-Membrane component... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
684,00 €
Anti-TM4SF1
Artikelnummer: ARG40597.50
| Schlagworte: | Anti-M3S1, Anti-TM4SF1, Anti-Tumor-associated antigen L6, Anti-Transmembrane 4 L6 family member 1, Anti-Membrane component... |
| Anwendung: | IHC (paraffin), WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
520,00 €
Anti-TM4SF1
Artikelnummer: G-PACO20646.50
TM4SF1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, IHC applications. TM4SF1 Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-M3S1, Anti-TM4SF1, Anti-Tumor-associated antigen L6, Anti-Transmembrane 4 L6 family member 1, Anti-Membrane component... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
363,00 €
Anti-TM4SF1
Artikelnummer: G-PACO20647.50
TM4SF1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, IHC applications. TM4SF1 Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-M3S1, Anti-TM4SF1, Anti-Tumor-associated antigen L6, Anti-Transmembrane 4 L6 family member 1, Anti-Membrane component... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
363,00 €
Anti-TM4SF1
Artikelnummer: G-PACO30434.50
TM4SF1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. TM4SF1 Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-M3S1, Anti-TM4SF1, Anti-Tumor-associated antigen L6, Anti-Transmembrane 4 L6 family member 1, Anti-Membrane component... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
363,00 €
Anti-TM4SF1
Artikelnummer: ATA-HPA002823.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 75% and to rat: 77%
| Schlagworte: | Anti-M3S1, Anti-TM4SF1, Anti-Tumor-associated antigen L6, Anti-Transmembrane 4 L6 family member 1, Anti-Membrane component... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 335,00 €
Anti-TM4SF1
Artikelnummer: ELK-ES6146.100
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation...
| Schlagworte: | Anti-M3S1, Anti-TM4SF1, Anti-Tumor-associated antigen L6, Anti-Transmembrane 4 L6 family member 1, Anti-Membrane component... |
| Anwendung: | IHC, IF, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 169,00 €
Anti-TM4SF1 (PACO04259)
Artikelnummer: G-PACO04259.50
TM4SF1 Antibody (PACO04259)
| Schlagworte: | Anti-M3S1, Anti-TM4SF1, Anti-Tumor-associated antigen L6, Anti-Transmembrane 4 L6 family member 1, Anti-Membrane component... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
320,00 €
TM4SF1 PrEST Antigen
Artikelnummer: ATA-APrEST85203.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | M3S1, TM4SF1, Tumor-associated antigen L6, Transmembrane 4 L6 family member 1, Membrane component chromosome 3 surface... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
247,00 €
TM4SF1, Recombinant, Human, aa115-161, His-Tag...
Artikelnummer: 375595.100
Source:, Recombinant protein corresponding to aa115-161 from human TM4SF1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~7.3kD, AA Sequence: LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing...
| Schlagworte: | M3S1, TM4SF1, Tumor-associated antigen L6, Transmembrane 4 L6 family member 1, Membrane component chromosome 3 surface... |
| MW: | 7,3 |
ab 621,00 €
Anti-T4S1
Artikelnummer: ABD-8C10517.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-T4S1 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Schlagworte: | Anti-M3S1, Anti-TM4SF1, Anti-Tumor-associated antigen L6, Anti-Transmembrane 4 L6 family member 1, Anti-Membrane component... |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
601,00 €