Zu "P29400" wurden 14 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
-10 %
Rabattaktion
Human COL4a5 (Collagen Type IV Alpha 5) ELISA Kit
Human COL4a5 (Collagen Type IV Alpha 5) ELISA Kit

Artikelnummer: ELK-ELK5603.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human COL4a5. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human COL4a5....
Schlagworte: COL4A5, Collagen alpha-5(IV) chain
Anwendung: ELISA
Spezies-Reaktivität: human
365,00 € ab 328,50 €
Bewerten
Anti-COL4A5
Anti-COL4A5

Artikelnummer: G-CAB9809.100

Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 352,00 €
Bewerten
Anti-Collagen IV alpha 5, clone SQab22254
Anti-Collagen IV alpha 5, clone SQab22254

Artikelnummer: ARG66926.100

Protein function: Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. [The UniProt Consortium]
Schlagworte: Anti-COL4A5, Anti-Collagen alpha-5(IV) chain, Anti-Collagen alpha-5(IV) chain
Anwendung: IHC (paraffin)
Wirt: Rabbit
Spezies-Reaktivität: human
ab 408,00 €
Bewerten
-10 %
Rabattaktion
Anti-COL4A5
Anti-COL4A5

Artikelnummer: ELK-ES4740.100

This gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes. Mutations in this gene are associated with X-linked Alport syndrome, also known as hereditary nephritis. Like the other members of the type IV collagen gene family, this gene is organized in a...
Schlagworte: Anti-COL4A5, Anti-Collagen alpha-5(IV) chain, COL4A5 rabbit pAb
Anwendung: IHC, IF, WB, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
169,00 € ab 152,10 €
Bewerten
COL4A5, Human collagen, type IV, alpha 5, Real Time PCR Primer Set
COL4A5, Human collagen, type IV, alpha 5, Real Time PCR...

Artikelnummer: VHPS-2112

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: COL4A5, Collagen alpha-5(IV) chain
Anwendung: RNA quantification
43,00 €
Bewerten
Anti-COL4A5, NT (COL4A5, Collagen alpha-5(IV) chain) (Azide free) (APC)
Anti-COL4A5, NT (COL4A5, Collagen alpha-5(IV) chain)...

Artikelnummer: 034094-APC.200

Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Applications: Suitable for use in Western Blot, FLISA, Recommended Dilution: FLISA: 1:1,000, Western Blot: 1:100-500, Storage and...
Schlagworte: Anti-COL4A5, Anti-Collagen alpha-5(IV) chain
Anwendung: FLISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
993,00 €
Bewerten
Anti-COL4A5, NT (COL4A5, Collagen alpha-5(IV) chain) (Azide Free) (Biotin)
Anti-COL4A5, NT (COL4A5, Collagen alpha-5(IV) chain)...

Artikelnummer: 034094-Biotin.200

Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and...
Schlagworte: Anti-COL4A5, Anti-Collagen alpha-5(IV) chain
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
993,00 €
Bewerten
Anti-COL4A5, NT (COL4A5, Collagen alpha-5(IV) chain) (Azide free) (FITC)
Anti-COL4A5, NT (COL4A5, Collagen alpha-5(IV) chain)...

Artikelnummer: 034094-FITC.200

Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Applications: Suitable for use in Western Blot, FLISA, Recommended Dilution: FLISA: 1:1,000, Western Blot: 1:100-500, Storage and...
Schlagworte: Anti-COL4A5, Anti-Collagen alpha-5(IV) chain
Anwendung: FLISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
993,00 €
Bewerten
Anti-COL4A5, NT (COL4A5, Collagen alpha-5(IV) chain) (Azide free) (HRP)
Anti-COL4A5, NT (COL4A5, Collagen alpha-5(IV) chain)...

Artikelnummer: 034094-HRP.200

Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and...
Schlagworte: Anti-COL4A5, Anti-Collagen alpha-5(IV) chain
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
993,00 €
Bewerten
Anti-COL4A5, NT (COL4A5, Collagen alpha-5(IV) chain)
Anti-COL4A5, NT (COL4A5, Collagen alpha-5(IV) chain)

Artikelnummer: 034094.200

Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and...
Schlagworte: Anti-COL4A5, Anti-Collagen alpha-5(IV) chain
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
728,00 €
Bewerten
Collagen Type IV Alpha 5 (COL4a5) Recombinant, Human
Collagen Type IV Alpha 5 (COL4a5) Recombinant, Human

Artikelnummer: 154093.10

Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P29400, Fragment: Gly1461~Thr1685 (Accession No: P29400), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-GFLITRHSQT TDAPQCPQGT LQVYEGFSLL YVQGNKRAHG QDLGTAGSCL RRFSTMPFMF...
ab 361,00 €
Bewerten
Collagen Type IV Alpha 5 (COL4a5) BioAssay(TM) ELISA Kit (Human)
Collagen Type IV Alpha 5 (COL4a5) BioAssay(TM) ELISA Kit...

Artikelnummer: 517108.96

This sandwich ELISA kit is used for in vitro quantitative measurement of COL4a5 in human serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. Sensitivity: 1.12ng/ml, Range: 3.12-200ng/ml, Specificity: This assay has high sensitivity and excellent specificity for...
Schlagworte: COL4A5, Collagen alpha-5(IV) chain
Anwendung: ELISA
Spezies-Reaktivität: human
999,00 €
Bewerten
1 von 2 Seiten