Zu "P26894" wurden 21 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Interleukin-8 (IL-8) (swine) Do-It-Yourself ELISA
Artikelnummer: DIY0728S-003
The swine IL-8 Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a swine IL-8 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for...
| Schlagworte: | IL8, IL-8, CXCL8, Interleukin-8, C-X-C motif chemokine 8 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
ab 1.098,00 €
IL-8 (pig) ELISA kit
Artikelnummer: BR-A05421.96
Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
802,00 €
Anti-Interleukin-8 (IL-8) (swine)
Artikelnummer: PB0143S-100
Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]
| Schlagworte: | Anti-IL-8, Anti-IL8, Anti-C-X-C motif chemokine 8, Anti-CXCL8 |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | swine, bovine, dog, feline, rabbit |
549,00 €
Porcine IL-8(Interleukin-8) ELISA Kit
Artikelnummer: G-PRFI00169.96
Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
698,00 €
NEU
Porcine IL-8 (Interleukin 8) Superset Max DIY ELISA
Artikelnummer: G-AEES05437.480
Porcine IL-8 (Interleukin 8) Superset Max DIY ELISA Protein Function: Chemotactic factor that mediates inflammatory response by attracting neutrophils, basophils, and T-cells to clear pathogens and protect the host from infection. Also plays an important role in neutrophil activation. Released in response to an...
| Schlagworte: | CXCL8, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage chemotactic factor I |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
919,00 €
NEU
Pig IL8 (Interleukin 8) ELISA Kit
Artikelnummer: G-AEKE05600.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig IL8. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig IL8. Next, Avidin...
| Schlagworte: | CXCL8, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage chemotactic factor I |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
694,00 €
IL-8, Swine
Artikelnummer: CR-C03006-100UG
Sequence: MARVSAELRC QCINTHSTPF HPKFIKELRV IESGPHCENS EIIVKLVNGK EVCLDPKEKW VQKVVQIFLK with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It...
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
ab 618,00 €
Pig interleukin 8, IL-8 ELISA Kit
Artikelnummer: CSB-E06787p.48
Sample Types: serum, plasma, cell culture supernates, tissue homogenates Detection Range: 125 pg/mL-8000 pg/mL Sensitivity: 31.25 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: IL-8 is a chemotactic factor that attracts...
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | swine |
ab 420,00 €
Interleukin 8 (IL8) Instant BioAssay(TM) ELISA Kit (Porcine)
Artikelnummer: 517374.96
Specificity:, This assay has high sensitivity and excellent specificity for detection of Instant Interleukin 8 (IL8). No significant cross-reactivity or interference between Instant Interleukin 8 (IL8) and analogues was observed. Precision: Intra-Assay: CV<10% , Inter-Assay: CV<12%, Kit Components: 96-well strip...
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
1.104,00 €
Pig IL8 (Interleukin 8) ELISA Kit
Artikelnummer: ELK-ELK1219.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig IL8. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig IL8. Next, Avidin...
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
ab 432,00 €
-10 %
Rabattaktion
Porcine IL-8(Interleukin 8) ELISA Kit
Artikelnummer: E-EL-P3004.24
Colormetric. Detection Range: 1.56-100 pg/mL. Sensitivity: 0.83 pg/mL. Recovery rate: 80%-120%. Precision: Both intra-CV and inter-CV are < 10%.
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
122,00 €
ab 109,80 €
IL-8 protein(N-His)(active) (recombinant swine)
Artikelnummer: E-PKSS000006.5
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <5 ng/mL. Sequence: MTSKLAVAFLAVFLLSAALCEAAVLARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ. Fusion tag: N-His Endotoxin: Please contact us for more information....
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | Active, cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 12.46 kD |
192,00 €